SysQuan Human Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/µg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/µg)	Incorp. (%)	Assays Available	PTM
P55287	CDH11	DTNRPLEPPSEFIVK	Spleen	—	100.0	None	—
P55287	CDH11	EEYHVVIQAK	kidney	—	100.0	None	—
P55287	CDH11	EEYHVVIQAK	lung	—	100.0	None	—
P55287	CDH11	EEYHVVIQAK	Spleen	—	100.0	None	—
P55287	CDH11	KPVDFETK	lung	—	100.0	None	—
P55287	CDH11	LHSDIDSGDGNIK	lung	—	100.0	None	—
P55287	CDH11	LHSDIDSGDGNIK	Spleen	—	100.0	None	—
P55287	CDH11	YILSGEGAGTIFVIDDK	kidney	—	100.0	None	—
P55287	CDH11	YILSGEGAGTIFVIDDK	lung	—	100.0	None	—
P55287	CDH11	YILSGEGAGTIFVIDDK	Spleen	—	100.0	None	—
P55290	CDH13	ETLENPK	Heart	—	100.0	None	—
P55290	CDH13	PLDYEISAFHTLLIK	Heart	—	100.0	None	—
P55327	TPD52	ASAAFSSVGSVITK	Heart	—	100.0	None	—
P55327	TPD52	ASAAFSSVGSVITK	kidney	—	100.0	None	—
P55327	TPD52	ASAAFSSVGSVITK	liver	—	100.0	None	—
P55327	TPD52	VEEEIQTLSQVLAAK	Heart	—	100.0	None	—
P55327	TPD52	VEEEIQTLSQVLAAK	liver	—	100.0	None	—
P55327	TPD52	VEEEIQTLSQVLAAK	lung	—	100.0	None	—
P55345	PRMT2	VLFWDNAYEFNLSALK	lung	—	100.0	None	—
P55345	PRMT2	YHSVILQNK	lung	—	100.0	None	—
P55347	PKNOX1	IHLLELEK	lung	—	100.0	None	—
P55347	PKNOX1	IHLLELEK	Spleen	—	100.0	None	—
P55769	SNU13	TEADVNPK	Heart	—	100.0	None	—
P55769	SNU13	TEADVNPK	kidney	—	100.0	None	—
P55769	SNU13	TEADVNPK	liver	—	100.0	None	—
P55769	SNU13	TEADVNPK	lung	—	100.0	None	—
P55786	NPEPPS	AGIISTVEVLK	dbs	—	100.0	None	—
P55786	NPEPPS	AGIISTVEVLK	Heart	—	100.0	None	—
P55786	NPEPPS	AGIISTVEVLK	kidney	—	100.0	None	—
P55786	NPEPPS	AQELDALDNSHPIEVSVGHPSEVDEIFDAISYSK	lung	—	100.0	None	—
P55786	NPEPPS	ATFDISLVVPK	dbs	—	100.0	None	—
P55786	NPEPPS	ATFDISLVVPK	Heart	—	100.0	None	—
P55786	NPEPPS	ATFDISLVVPK	liver	—	100.0	None	—
P55786	NPEPPS	ATFDISLVVPK	lung	—	100.0	None	—
P55786	NPEPPS	DYFNVPYPLPK	lung	—	100.0	None	—
P55786	NPEPPS	ETALLIDPK	dbs	—	100.0	None	—
P55786	NPEPPS	ETALLIDPK	Heart	—	100.0	None	—
P55786	NPEPPS	ETALLIDPK	kidney	—	100.0	None	—
P55786	NPEPPS	ETALLIDPK	lung	—	100.0	None	—
P55786	NPEPPS	ETALLIDPK	Spleen	—	100.0	None	—
P55786	NPEPPS	FALEVAAK	liver	—	100.0	None	—
P55786	NPEPPS	FALEVAAK	lung	—	100.0	None	—
P55786	NPEPPS	FALEVAAK	Spleen	—	100.0	None	—
P55786	NPEPPS	KPYPDDENLVEVK	dbs	—	100.0	None	—
P55786	NPEPPS	KPYPDDENLVEVK	Heart	—	100.0	None	—
P55786	NPEPPS	KPYPDDENLVEVK	kidney	—	100.0	None	—
P55786	NPEPPS	KPYPDDENLVEVK	liver	—	100.0	None	—
P55786	NPEPPS	KPYPDDENLVEVK	lung	—	100.0	None	—
P55786	NPEPPS	LGWDPKPGEGHLDALLR	dbs	—	100.0	None	—
P55786	NPEPPS	LGWDPKPGEGHLDALLR	kidney	—	100.0	None	—

SysQuan Human Database

Cart (0)