SysQuan Human Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/µg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/µg)	Incorp. (%)	Assays Available	PTM
P52272	HNRNPM	NLPFDFTWK	Spleen	—	100.0	None	—
P52294	KPNA1	EAAWAITNATSGGSAEQIK	dbs	—	100.0	None	—
P52294	KPNA1	EAAWAITNATSGGSAEQIK	Heart	—	100.0	None	—
P52294	KPNA1	EAAWAITNATSGGSAEQIK	liver	—	100.0	None	—
P52294	KPNA1	EAAWAITNATSGGSAEQIK	lung	—	100.0	None	—
P52298	NCBP2	TDWDAGFK	Heart	—	100.0	None	—
P52298	NCBP2	TDWDAGFK	kidney	—	100.0	None	—
P52298	NCBP2	TDWDAGFK	liver	—	100.0	None	—
P52298	NCBP2	TDWDAGFK	lung	—	100.0	None	—
P52298	NCBP2	TDWDAGFK	Spleen	—	100.0	None	—
P52306	RAP1GDS1	EVQDLAFLDVVSK	Heart	—	100.0	None	—
P52306	RAP1GDS1	EVQDLAFLDVVSK	kidney	—	100.0	None	—
P52306	RAP1GDS1	EVQDLAFLDVVSK	liver	—	100.0	None	—
P52306	RAP1GDS1	EVQDLAFLDVVSK	lung	—	100.0	None	—
P52306	RAP1GDS1	EVQDLAFLDVVSK	Spleen	—	100.0	None	—
P52306	RAP1GDS1	TIVQSGGIK	Heart	—	100.0	None	—
P52306	RAP1GDS1	TIVQSGGIK	kidney	—	100.0	None	—
P52306	RAP1GDS1	TIVQSGGIK	Spleen	—	100.0	None	—
P52333	JAK3	ALHSDFIVK	Spleen	—	100.0	None	—
P52333	JAK3	LADFGLAK	Spleen	—	100.0	None	—
P52333	JAK3	NILVESEAHVK	lung	—	100.0	None	—
P52333	JAK3	NILVESEAHVK	Spleen	—	100.0	None	—
P52429	DGKE	ILLNPVQVFDVTK	Heart	—	100.0	None	—
P52429	DGKE	ILLNPVQVFDVTK	kidney	—	100.0	None	—
P52429	DGKE	ILLNPVQVFDVTK	liver	—	100.0	None	—
P52429	DGKE	ILLNPVQVFDVTK	lung	—	100.0	None	—
P52429	DGKE	ILLNPVQVFDVTK	Spleen	—	100.0	None	—
P52434	POLR2H	AGILFEDIFDVK	kidney	—	100.0	None	—
P52434	POLR2H	AGILFEDIFDVK	liver	—	100.0	None	—
P52434	POLR2H	AGILFEDIFDVK	lung	—	100.0	None	—
P52434	POLR2H	AGILFEDIFDVK	Spleen	—	100.0	None	—
P52435	POLR2J	DPQVLFAGYK	liver	—	100.0	None	—
P52435	POLR2J	EDHTLGNIIK	kidney	—	100.0	None	—
P52435	POLR2J	EDHTLGNIIK	liver	—	100.0	None	—
P52564	MAP2K6	GQTIPEDILGK	Heart	—	100.0	None	—
P52564	MAP2K6	GQTIPEDILGK	liver	—	100.0	None	—
P52564	MAP2K6	GQTIPEDILGK	lung	—	100.0	None	—
P52564	MAP2K6	IAVSIVK	lung	—	100.0	None	—
P52564	MAP2K6	QVVEEPSPQLPADK	Heart	—	100.0	None	—
P52564	MAP2K6	QVVEEPSPQLPADK	kidney	—	100.0	None	—
P52564	MAP2K6	QVVEEPSPQLPADK	liver	—	100.0	None	—
P52564	MAP2K6	QVVEEPSPQLPADK	lung	—	100.0	None	—
P52564	MAP2K6	QVVEEPSPQLPADK	Spleen	—	100.0	None	—
P52565	ARHGDIA	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQK	liver	—	100.0	None	—
P52565	ARHGDIA	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQK	lung	—	100.0	None	—
P52565	ARHGDIA	AEQEPTAEQLAQIAAENEEDEHSVNYKPPAQK	plasma	—	100.0	None	—
P52565	ARHGDIA	TDHLSWEWNLTIK	kidney	—	100.0	None	—
P52565	ARHGDIA	TDHLSWEWNLTIK	Spleen	—	100.0	None	—
P52566	ARHGDIB	DIVSGLK	dbs	—	100.0	None	—
P52566	ARHGDIB	DIVSGLK	Heart	—	100.0	None	—

SysQuan Human Database

Cart (0)