SysQuan Human Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/µg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/µg)	Incorp. (%)	Assays Available	PTM
P16333	NCK1	EDELSLIK	lung	—	100.0	None	—
P16333	NCK1	EDELSLIK	Spleen	—	100.0	None	—
P16333	NCK1	FAGNPWYYGK	liver	—	100.0	None	—
P16333	NCK1	FDYVAQQEQELDIK	Heart	—	100.0	None	—
P16333	NCK1	FDYVAQQEQELDIK	kidney	—	100.0	None	—
P16333	NCK1	FDYVAQQEQELDIK	liver	—	100.0	None	—
P16333	NCK1	FDYVAQQEQELDIK	Spleen	—	100.0	None	—
P16333	NCK1	LAAVVNNLNTGQVLHVVQALYPFSSSNDEELNFEK	lung	—	100.0	None	—
P16333	NCK1	LWLLDDSK	Heart	—	100.0	None	—
P16333	NCK1	LWLLDDSK	kidney	—	100.0	None	—
P16333	NCK1	LWLLDDSK	liver	—	100.0	None	—
P16333	NCK1	LWLLDDSK	lung	—	100.0	None	—
P16401	H1-5	ALAAGGYDVEK	kidney	—	100.0	None	—
P16401	H1-5	ALAAGGYDVEK	liver	—	100.0	None	—
P16401	H1-5	ALAAGGYDVEK	lung	—	100.0	None	—
P16401	H1-5	ALAAGGYDVEK	plasma	—	100.0	None	—
P16401	H1-5	ALAAGGYDVEK	Spleen	—	100.0	None	—
P16401	H1-5	GTGASGSFK	Heart	—	100.0	None	—
P16401	H1-5	GTGASGSFK	kidney	—	100.0	None	—
P16401	H1-5	GTGASGSFK	liver	—	100.0	None	—
P16401	H1-5	GTGASGSFK	lung	—	100.0	None	—
P16401	H1-5	GTGASGSFK	Spleen	—	100.0	None	—
P16401	H1-5	GTLVQTK	Heart	—	100.0	None	—
P16401	H1-5	GTLVQTK	liver	—	100.0	None	—
P16401	H1-5	GTLVQTK	lung	—	100.0	None	—
P16422	EPCAM	TYWIIIELK	kidney	—	100.0	None	—
P16422	EPCAM	TYWIIIELK	lung	—	100.0	None	—
P16435	POR	ESSFVEK	Heart	—	100.0	None	—
P16435	POR	ESSFVEK	kidney	—	100.0	None	—
P16435	POR	ESSFVEK	lung	—	100.0	None	—
P16435	POR	VYVQHLLK	Heart	—	100.0	None	—
P16435	POR	VYVQHLLK	kidney	—	100.0	None	—
P16435	POR	VYVQHLLK	liver	—	100.0	None	—
P16435	POR	VYVQHLLK	lung	—	100.0	None	—
P16435	POR	VYVQHLLK	Spleen	—	100.0	None	—
P16435	POR	YYSIASSSK	liver	—	100.0	None	—
P16435	POR	YYSIASSSK	lung	—	100.0	None	—
P16591	FER	EDLPQELK	Heart	—	100.0	None	—
P16591	FER	IEAQELLK	liver	—	100.0	None	—
P16591	FER	IEAQELLK	lung	—	100.0	None	—
P16591	FER	IEAQELLK	Spleen	—	100.0	None	—
P16591	FER	QALEELK	lung	—	100.0	None	—
P16591	FER	QEDGGVYSSSGLK	Heart	—	100.0	None	—
P16591	FER	QEDGGVYSSSGLK	lung	—	100.0	None	—
P16591	FER	SGVVLLNPIPK	kidney	—	100.0	None	—
P16591	FER	SGVVLLNPIPK	liver	—	100.0	None	—
P16591	FER	SGVVLLNPIPK	lung	—	100.0	None	—
P16615	ATP2A2	DIVPGDIVEIAVGDK	kidney	—	100.0	None	—
P16615	ATP2A2	DIVPGDIVEIAVGDK	liver	—	100.0	None	—
P16615	ATP2A2	DIVPGDIVEIAVGDK	lung	—	100.0	None	—

SysQuan Human Database

Cart (0)