SysQuan Human Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/µg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/µg)	Incorp. (%)	Assays Available	PTM
O75475	PSIP1	VDEVPDGAVKPPTNK	Spleen	—	100.0	None	—
O75477	ERLIN1	ADAEYYAAHK	kidney	—	100.0	None	—
O75477	ERLIN1	ADAEYYAAHK	liver	—	100.0	None	—
O75477	ERLIN1	ADAEYYAAHK	lung	—	100.0	None	—
O75477	ERLIN1	ADAEYYAAHK	Spleen	—	100.0	None	—
O75477	ERLIN1	AVIEAEK	kidney	—	100.0	None	—
O75477	ERLIN1	YQAIASNSK	kidney	—	100.0	None	—
O75477	ERLIN1	YQAIASNSK	lung	—	100.0	None	—
O75477	ERLIN1	YQAIASNSK	Spleen	—	100.0	None	—
O75478	TADA2A	DIDFVEDDSDILHALK	Spleen	—	100.0	None	—
O75487	GPC4	DLFVELK	Heart	—	100.0	None	—
O75487	GPC4	DLFVELK	kidney	—	100.0	None	—
O75487	GPC4	DLFVELK	liver	—	100.0	None	—
O75487	GPC4	DLFVELK	lung	—	100.0	None	—
O75487	GPC4	DLFVELK	Spleen	—	100.0	None	—
O75487	GPC4	ELLENAEK	Heart	—	100.0	None	—
O75487	GPC4	ELLENAEK	kidney	—	100.0	None	—
O75487	GPC4	ELLENAEK	lung	—	100.0	None	—
O75487	GPC4	YLFAVTGNGLANQGNNPEVQVDTSKPDILILR	liver	—	100.0	None	—
O75487	GPC4	YTEQLKPFGDVPR	liver	—	100.0	None	—
O75487	GPC4	YTEQLKPFGDVPR	Spleen	—	100.0	None	—
O75489	NDUFS3	DHTNAQFK	Heart	—	100.0	None	—
O75489	NDUFS3	DHTNAQFK	kidney	—	100.0	None	—
O75489	NDUFS3	DHTNAQFK	liver	—	100.0	None	—
O75489	NDUFS3	DHTNAQFK	Spleen	—	100.0	None	—
O75489	NDUFS3	QPPESLK	Heart	—	100.0	None	—
O75489	NDUFS3	QPPESLK	kidney	—	100.0	None	—
O75489	NDUFS3	QPPESLK	liver	—	100.0	None	—
O75509	TNFRSF21	LFEIIGVK	kidney	—	100.0	None	—
O75509	TNFRSF21	LFEIIGVK	Spleen	—	100.0	None	—
O75509	TNFRSF21	LVAAQVGSQWK	kidney	—	100.0	None	—
O75509	TNFRSF21	LVAAQVGSQWK	Spleen	—	100.0	None	—
O75521	ECI2	WDAWNALGSLPK	Heart	—	100.0	None	—
O75521	ECI2	WDAWNALGSLPK	kidney	—	100.0	None	—
O75521	ECI2	WDAWNALGSLPK	liver	—	100.0	None	—
O75521	ECI2	WDAWNALGSLPK	lung	—	100.0	None	—
O75521	ECI2	WDAWNALGSLPK	Spleen	—	100.0	None	—
O75525	KHDRBS3	LQEETLTK	Heart	—	100.0	None	—
O75525	KHDRBS3	LQEETLTK	kidney	—	100.0	None	—
O75525	KHDRBS3	LQEETLTK	lung	—	100.0	None	—
O75525	KHDRBS3	LQEETLTK	Spleen	—	100.0	None	—
O75525	KHDRBS3	YIDVVINK	liver	—	100.0	None	—
O75525	KHDRBS3	YIDVVINK	lung	—	100.0	None	—
O75528	TADA3	DVDALLK	kidney	—	100.0	None	—
O75528	TADA3	DVDALLK	lung	—	100.0	None	—
O75528	TADA3	DVDALLK	Spleen	—	100.0	None	—
O75528	TADA3	VLEAETQILTDWQDK	Heart	—	100.0	None	—
O75528	TADA3	VLEAETQILTDWQDK	kidney	—	100.0	None	—
O75528	TADA3	VLEAETQILTDWQDK	liver	—	100.0	None	—
O75528	TADA3	VLEAETQILTDWQDK	Spleen	—	100.0	None	—

SysQuan Human Database

Cart (0)