SysQuan Human Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/µg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/µg)	Incorp. (%)	Assays Available	PTM
O15143	ARPC1B	EVEERPAPTPWGSK	plasma	—	100.0	None	—
O15143	ARPC1B	EVEERPAPTPWGSK	Spleen	—	100.0	None	—
O15143	ARPC1B	IFSAYIK	dbs	—	100.0	None	—
O15143	ARPC1B	IFSAYIK	Heart	—	100.0	None	—
O15143	ARPC1B	IFSAYIK	kidney	—	100.0	None	—
O15143	ARPC1B	IFSAYIK	liver	—	100.0	None	—
O15143	ARPC1B	IFSAYIK	lung	—	100.0	None	—
O15143	ARPC1B	IFSAYIK	Spleen	—	100.0	None	—
O15143	ARPC1B	NAYVWTLK	dbs	—	100.0	None	—
O15143	ARPC1B	NAYVWTLK	Heart	—	100.0	None	—
O15143	ARPC1B	NAYVWTLK	kidney	—	100.0	None	—
O15143	ARPC1B	NAYVWTLK	plasma	—	100.0	None	—
O15143	ARPC1B	PAPTPWGSK	Heart	—	100.0	None	—
O15143	ARPC1B	PAPTPWGSK	liver	—	100.0	None	—
O15143	ARPC1B	SLESALK	dbs	—	100.0	None	—
O15143	ARPC1B	SLESALK	Heart	—	100.0	None	—
O15143	ARPC1B	SLESALK	liver	—	100.0	None	—
O15143	ARPC1B	SLESALK	lung	—	100.0	None	—
O15143	ARPC1B	SLESALK	plasma	—	100.0	None	—
O15143	ARPC1B	WAPNENK	Heart	—	100.0	None	—
O15143	ARPC1B	WAPNENK	kidney	—	100.0	None	—
O15143	ARPC1B	WAPNENK	liver	—	100.0	None	—
O15144	ARPC2	DDDDVVIGK	kidney	—	100.0	None	—
O15144	ARPC2	DDDDVVIGK	liver	—	100.0	None	—
O15144	ARPC2	DDDDVVIGK	lung	—	100.0	None	—
O15144	ARPC2	DDDDVVIGK	plasma	—	100.0	None	—
O15144	ARPC2	DYLHYHIK	dbs	—	100.0	None	—
O15144	ARPC2	DYLHYHIK	Heart	—	100.0	None	—
O15144	ARPC2	EPPLELK	dbs	—	100.0	None	—
O15144	ARPC2	EPPLELK	Heart	—	100.0	None	—
O15144	ARPC2	EPPLELK	kidney	—	100.0	None	—
O15144	ARPC2	EPPLELK	liver	—	100.0	None	—
O15144	ARPC2	EPPLELK	lung	—	100.0	None	—
O15144	ARPC2	FENAAAGNKPEAVEVTFADFDGVLYHISNPNGDK	liver	—	100.0	None	—
O15144	ARPC2	VTVVFSTVFK	liver	—	100.0	None	—
O15144	ARPC2	VTVVFSTVFK	Spleen	—	100.0	None	—
O15145	ARPC3	DTDIVDEAIYYFK	dbs	—	100.0	None	—
O15145	ARPC3	DTDIVDEAIYYFK	Heart	—	100.0	None	—
O15145	ARPC3	DTDIVDEAIYYFK	kidney	—	100.0	None	—
O15145	ARPC3	DTDIVDEAIYYFK	liver	—	100.0	None	—
O15145	ARPC3	DTDIVDEAIYYFK	lung	—	100.0	None	—
O15145	ARPC3	DTDIVDEAIYYFK	plasma	—	100.0	None	—
O15156	ZBTB7B	FLHSYDLK	kidney	—	100.0	None	—
O15156	ZBTB7B	FLHSYDLK	liver	—	100.0	None	—
O15156	ZBTB7B	FLHSYDLK	lung	—	100.0	None	—
O15156	ZBTB7B	FLHSYDLK	Spleen	—	100.0	None	—
O15160	POLR1C	DHYIFSVESTGVLPPDVLVSEAIK	kidney	—	100.0	None	—
O15160	POLR1C	DHYIFSVESTGVLPPDVLVSEAIK	Spleen	—	100.0	None	—
O15160	POLR1C	DSSDPNELYVNHK	kidney	—	100.0	None	—
O15160	POLR1C	DSSDPNELYVNHK	liver	—	100.0	None	—

SysQuan Human Database

Cart (0)