SysQuan Human Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/µg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/µg)	Incorp. (%)	Assays Available	PTM
O00160	MYO1F	VDFADSVTK	lung	—	100.0	None	—
O00160	MYO1F	VDFADSVTK	Spleen	—	100.0	None	—
O00161	SNAP23	TLTELNK	Heart	—	100.0	None	—
O00161	SNAP23	TLTELNK	kidney	—	100.0	None	—
O00161	SNAP23	TLTELNK	lung	—	100.0	None	—
O00161	SNAP23	TLTELNK	Spleen	—	100.0	None	—
O00170	AIP	AHAAVWNAQEAQADFAK	Heart	—	100.0	None	—
O00170	AIP	AHAAVWNAQEAQADFAK	kidney	—	100.0	None	—
O00170	AIP	AHAAVWNAQEAQADFAK	liver	—	100.0	None	—
O00170	AIP	AHAAVWNAQEAQADFAK	lung	—	100.0	None	—
O00170	AIP	AHAAVWNAQEAQADFAK	Spleen	—	100.0	None	—
O00170	AIP	GELPDFQDGTK	Heart	—	100.0	None	—
O00170	AIP	GELPDFQDGTK	kidney	—	100.0	None	—
O00170	AIP	GELPDFQDGTK	liver	—	100.0	None	—
O00170	AIP	GELPDFQDGTK	lung	—	100.0	None	—
O00178	GTPBP1	EHLGLALALNVPVFVVVTK	dbs	—	100.0	None	—
O00178	GTPBP1	EHLGLALALNVPVFVVVTK	Spleen	—	100.0	None	—
O00178	GTPBP1	IPVLVQSK	Heart	—	100.0	None	—
O00178	GTPBP1	IPVLVQSK	kidney	—	100.0	None	—
O00178	GTPBP1	IPVLVQSK	liver	—	100.0	None	—
O00178	GTPBP1	IPVLVQSK	lung	—	100.0	None	—
O00178	GTPBP1	IPVLVQSK	Spleen	—	100.0	None	—
O00178	GTPBP1	LNDTLLLGPDPLGNFLSIAVK	dbs	—	100.0	None	—
O00178	GTPBP1	TSSVGNDILGFDSEGNVVNKPDSHGGSLEWTK	lung	—	100.0	None	—
O00178	GTPBP1	VAVVGNVDAGK	dbs	—	100.0	None	—
O00178	GTPBP1	VITFIDLAGHEK	dbs	—	100.0	None	—
O00178	GTPBP1	VITFIDLAGHEK	Heart	—	100.0	None	—
O00178	GTPBP1	VITFIDLAGHEK	kidney	—	100.0	None	—
O00178	GTPBP1	VITFIDLAGHEK	liver	—	100.0	None	—
O00178	GTPBP1	VITFIDLAGHEK	Spleen	—	100.0	None	—
O00186	STXBP3	HIAVVLEEIPK	Heart	—	100.0	None	—
O00186	STXBP3	HIAVVLEEIPK	kidney	—	100.0	None	—
O00186	STXBP3	HIAVVLEEIPK	liver	—	100.0	None	—
O00189	AP4M1	GDPLIYK	Spleen	—	100.0	None	—
O00192	ARVCF	AASHVLQTVWSYK	kidney	—	100.0	None	—
O00192	ARVCF	AASHVLQTVWSYK	liver	—	100.0	None	—
O00192	ARVCF	DAEWTTVFK	kidney	—	100.0	None	—
O00192	ARVCF	DAEWTTVFK	liver	—	100.0	None	—
O00192	ARVCF	DAEWTTVFK	lung	—	100.0	None	—
O00192	ARVCF	ELVTGTLWNLSSYEPLK	Heart	—	100.0	None	—
O00192	ARVCF	ELVTGTLWNLSSYEPLK	kidney	—	100.0	None	—
O00192	ARVCF	ELVTGTLWNLSSYEPLK	liver	—	100.0	None	—
O00192	ARVCF	GLPVLVELLQSETDK	Heart	—	100.0	None	—
O00192	ARVCF	GLPVLVELLQSETDK	kidney	—	100.0	None	—
O00192	ARVCF	GLPVLVELLQSETDK	liver	—	100.0	None	—
O00192	ARVCF	GLPVLVELLQSETDK	lung	—	100.0	None	—
O00192	ARVCF	GLPVLVELLQSETDK	Spleen	—	100.0	None	—
O00192	ARVCF	NFDTLDLPK	kidney	—	100.0	None	—
O00192	ARVCF	NFDTLDLPK	liver	—	100.0	None	—
O00192	ARVCF	NFDTLDLPK	lung	—	100.0	None	—

SysQuan Human Database

Cart (0)