SysQuan Human Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/µg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/µg)	Incorp. (%)	Assays Available	PTM
P31327	CPS1	TVLMNPNIASVQTNEVGLK	Spleen	—	100.0	MRM	['Meth']
P31327	CPS1	TVVVNCNPETVSTDFDECDK	liver	—	100.0	MRM	['Cys']
P31327	CPS1	VISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEK	liver	—	100.0	MRM	['Meth']
P31327	CPS1	VVAVDCGIK	liver	—	100.0	MRM	['Cys']
P31948	STIP1	ALDLDSSCK	dbs	—	100.0	MRM	['Cys']
P31948	STIP1	ALDLDSSCK	Heart	—	100.0	MRM	['Cys']
P31948	STIP1	ALDLDSSCK	kidney	—	100.0	MRM	['Cys']
P31948	STIP1	ALDLDSSCK	liver	—	100.0	MRM	['Cys']
P31948	STIP1	ALDLDSSCK	lung	—	100.0	MRM	['Cys']
P31948	STIP1	ALDLDSSCK	plasma	—	100.0	MRM	['Cys']
P31948	STIP1	LILEQMQK	dbs	—	100.0	MRM	['Meth']
P31948	STIP1	LILEQMQK	Heart	—	100.0	MRM	['Meth']
P31948	STIP1	LILEQMQK	kidney	—	100.0	MRM	['Meth']
P31948	STIP1	LILEQMQK	liver	—	100.0	MRM	['Meth']
P31948	STIP1	LILEQMQK	liver	—	100.0	MRM	['Meth']
P31948	STIP1	LILEQMQK	lung	—	100.0	MRM	['Meth']
P31948	STIP1	LILEQMQK	lung	—	100.0	MRM	['Meth']
P31948	STIP1	LILEQMQK	plasma	—	100.0	MRM	['Meth']
P31948	STIP1	LILEQMQK	Spleen	—	100.0	MRM	['Meth']
P32189	GK	SSSEIYGLMK	kidney	—	100.0	MRM	['Meth']
P32189	GK	SSSEIYGLMK	liver	—	100.0	MRM	['Meth']
P32929	CTH	ISFVDCSK	kidney	—	100.0	MRM	['Cys']
P34896	SHMT1	AVLEALGSCLNNK	dbs	—	100.0	MRM	['Cys']
P34896	SHMT1	AVLEALGSCLNNK	Heart	—	100.0	MRM	['Cys']
P34896	SHMT1	AVLEALGSCLNNK	kidney	—	100.0	MRM	['Cys']
P34896	SHMT1	AVLEALGSCLNNK	liver	—	100.0	MRM	['Cys']
P34896	SHMT1	AVLEALGSCLNNK	lung	—	100.0	MRM	['Cys']
P34896	SHMT1	IMGLDLPDGGHLTHGFMTDK	Heart	—	100.0	MRM	['Meth']
P34896	SHMT1	IMGLDLPDGGHLTHGFMTDK	kidney	—	100.0	MRM	['Meth']
P34896	SHMT1	IMGLDLPDGGHLTHGFMTDK	liver	—	100.0	MRM	['Meth']
P34896	SHMT1	IMGLDLPDGGHLTHGFMTDK	Spleen	—	100.0	MRM	['Meth']
P34896	SHMT1	ISATSIFFESMPYK	kidney	—	100.0	MRM	['Meth']
P34896	SHMT1	VLEACSIACNK	Heart	—	100.0	MRM	['Cys']
P34896	SHMT1	VLEACSIACNK	liver	—	100.0	MRM	['Cys']
P34896	SHMT1	VLEACSIACNK	lung	—	100.0	MRM	['Cys']
P34897	SHMT2	ISATSIFFESMPYK	dbs	—	100.0	MRM	['Meth']
P34897	SHMT2	ISATSIFFESMPYK	liver	—	100.0	MRM	['Meth']
P34897	SHMT2	ISATSIFFESMPYK	lung	—	100.0	MRM	['Meth']
P34897	SHMT2	ISATSIFFESMPYK	lung	—	100.0	MRM	['Meth']
P34897	SHMT2	ISATSIFFESMPYK	Spleen	—	100.0	MRM	['Meth']
P35520	CBS	CIIVMPEK	kidney	—	100.0	MRM	['Meth', 'Cys']
P35579	MYH9	IIGLDQVAGMSETALPGAFK	dbs	—	100.0	MRM	['Meth']
P35579	MYH9	IIGLDQVAGMSETALPGAFK	Heart	—	100.0	MRM	['Meth']
P35579	MYH9	IIGLDQVAGMSETALPGAFK	Heart	—	100.0	MRM	['Meth']
P35579	MYH9	IIGLDQVAGMSETALPGAFK	kidney	—	100.0	MRM	['Meth']
P35579	MYH9	IIGLDQVAGMSETALPGAFK	kidney	—	100.0	MRM	['Meth']
P35579	MYH9	IIGLDQVAGMSETALPGAFK	liver	—	100.0	MRM	['Meth']
P35579	MYH9	IIGLDQVAGMSETALPGAFK	lung	—	100.0	MRM	['Meth']
P35579	MYH9	IIGLDQVAGMSETALPGAFK	lung	—	100.0	MRM	['Meth']
P35579	MYH9	IIGLDQVAGMSETALPGAFK	Spleen	—	100.0	MRM	['Meth']

SysQuan Human Database

Cart (0)