SysQuan Human Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/µg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/µg)	Incorp. (%)	Assays Available	PTM
Q07973	CYP24A1	INPFAHLPFGVGK	kidney	—	100.0	None	—
Q08117	TLE5	HSGSSHLPQQLK	Heart	—	100.0	None	—
Q08117	TLE5	HSGSSHLPQQLK	kidney	—	100.0	None	—
Q08117	TLE5	HSGSSHLPQQLK	liver	—	100.0	None	—
Q08117	TLE5	HSGSSHLPQQLK	lung	—	100.0	None	—
Q08117	TLE5	HSGSSHLPQQLK	Spleen	—	100.0	None	—
Q08170	SRSF4	DADDAVYELNGK	kidney	—	100.0	None	—
Q08170	SRSF4	DADDAVYELNGK	lung	—	100.0	None	—
Q08170	SRSF4	DADDAVYELNGK	Spleen	—	100.0	None	—
Q08170	SRSF4	LVEDKPGSR	kidney	—	100.0	None	—
Q08170	SRSF4	LVEDKPGSR	liver	—	100.0	None	—
Q08170	SRSF4	LVEDKPGSR	lung	—	100.0	None	—
Q08170	SRSF4	LVEDKPGSR	Spleen	—	100.0	None	—
Q08170	SRSF4	QAGEVTYADAHK	kidney	—	100.0	None	—
Q08170	SRSF4	QAGEVTYADAHK	liver	—	100.0	None	—
Q08170	SRSF4	QAGEVTYADAHK	Spleen	—	100.0	None	—
Q08174	PCDH1	AQVVVTVK	liver	—	100.0	None	—
Q08174	PCDH1	AQVVVTVK	lung	—	100.0	None	—
Q08174	PCDH1	DAGPNGVASYELQAGPEAQELFGLQVAEDQEEK	lung	—	100.0	None	—
Q08174	PCDH1	DLYAPKPSGK	kidney	—	100.0	None	—
Q08174	PCDH1	DLYAPKPSGK	liver	—	100.0	None	—
Q08174	PCDH1	DLYAPKPSGK	lung	—	100.0	None	—
Q08174	PCDH1	SNSPLPSIQLQPQSPSASK	Heart	—	100.0	None	—
Q08174	PCDH1	SNSPLPSIQLQPQSPSASK	kidney	—	100.0	None	—
Q08174	PCDH1	SNSPLPSIQLQPQSPSASK	liver	—	100.0	None	—
Q08174	PCDH1	SNSPLPSIQLQPQSPSASK	lung	—	100.0	None	—
Q08174	PCDH1	SNSPLPSIQLQPQSPSASK	Spleen	—	100.0	None	—
Q08174	PCDH1	WDSYDLTIK	kidney	—	100.0	None	—
Q08174	PCDH1	WDSYDLTIK	liver	—	100.0	None	—
Q08174	PCDH1	WDSYDLTIK	lung	—	100.0	None	—
Q08209	PPP3CA	EESESVLTLK	Heart	—	100.0	None	—
Q08209	PPP3CA	EESESVLTLK	kidney	—	100.0	None	—
Q08209	PPP3CA	EESESVLTLK	lung	—	100.0	None	—
Q08209	PPP3CA	EESESVLTLK	Spleen	—	100.0	None	—
Q08209	PPP3CA	EVFDNDGKPR	Heart	—	100.0	None	—
Q08209	PPP3CA	EVFDNDGKPR	liver	—	100.0	None	—
Q08209	PPP3CA	HLTEYFTFK	kidney	—	100.0	None	—
Q08209	PPP3CA	HLTEYFTFK	liver	—	100.0	None	—
Q08209	PPP3CA	HLTEYFTFK	Spleen	—	100.0	None	—
Q08209	PPP3CA	ITSFEEAK	lung	—	100.0	None	—
Q08209	PPP3CA	QTLQSATVEAIEADEAIK	Heart	—	100.0	None	—
Q08209	PPP3CA	QTLQSATVEAIEADEAIK	lung	—	100.0	None	—
Q08209	PPP3CA	QTLQSATVEAIEADEAIK	Spleen	—	100.0	None	—
Q08211	DHX9	EEQEVQATLESEEVDLNAGLHGNWTLENAK	kidney	—	100.0	None	—
Q08211	DHX9	ETPFELIEALLK	lung	—	100.0	None	—
Q08211	DHX9	ETPFELIEALLK	Spleen	—	100.0	None	—
Q08211	DHX9	LGGIGQFLAK	dbs	—	100.0	None	—
Q08211	DHX9	LGGIGQFLAK	Heart	—	100.0	None	—
Q08211	DHX9	LGGIGQFLAK	liver	—	100.0	None	—
Q08211	DHX9	LGGIGQFLAK	lung	—	100.0	None	—

SysQuan Human Database

Cart (0)