SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
P30085	CMPK1	EMDQTMAANAQK	liver	—	100.0	MRM	['Meth']
P30085	CMPK1	EMDQTMAANAQK	lung	—	100.0	MRM	['Meth']
P30520	ADSS2	LDILDMFTEIK	kidney	—	100.0	MRM	['Meth']
P30520	ADSS2	LDILDMFTEIK	liver	—	100.0	MRM	['Meth']
P30520	ADSS2	LDILDMFTEIK	lung	—	100.0	MRM	['Meth']
P30837	ALDH1B1	LAPALATGNTVVMK	kidney	—	100.0	MRM	['Meth']
P30837	ALDH1B1	LAPALATGNTVVMK	liver	—	100.0	MRM	['Meth']
P31327	CPS1	TVLMNPNIASVQTNEVGLK	lung	—	100.0	MRM	['Meth']
P31327	CPS1	VISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEK	liver	—	100.0	MRM	['Meth']
P31930	UQCRC1	MVLAAAGGVEHQQLLDLAQK	kidney	—	100.0	MRM	['Meth']
P31930	UQCRC1	MVLAAAGGVEHQQLLDLAQK	liver	—	100.0	MRM	['Meth']
P31937	HIBADH	TPVGFIGLGNMGNPMAK	kidney	—	100.0	MRM	['Meth']
P34896	SHMT1	AVLEALGSCLNNK	dbs	—	100.0	MRM	['Cys']
P34896	SHMT1	AVLEALGSCLNNK	liver	—	100.0	MRM	['Cys']
P34896	SHMT1	AVLEALGSCLNNK	lung	—	100.0	MRM	['Cys']
P34896	SHMT1	IMGLDLPDGGHLTHGFMTDK	liver	—	100.0	MRM	['Meth']
P34897	SHMT2	AHLLADMAHISGLVAAK	liver	—	100.0	MRM	['Meth']
P34897	SHMT2	AHLLADMAHISGLVAAK	lung	—	100.0	MRM	['Meth']
P34897	SHMT2	ISATSIFFESMPYK	lung	—	100.0	MRM	['Meth']
P34913	EPHX2	EMVTFLDK	kidney	—	100.0	MRM	['Meth']
P34913	EPHX2	EMVTFLDK	liver	—	100.0	MRM	['Meth']
P35520	CBS	CIIVMPEK	kidney	—	100.0	MRM	['Meth', 'Cys']
P35625	TIMP3	SCYYLPCFVTSK	dbs	—	100.0	MRM	['Cys']
P35625	TIMP3	SCYYLPCFVTSK	plasma	—	100.0	MRM	['Cys']
P35914	HMGCL	GYVSCALGCPYEGK	kidney	—	100.0	MRM	['Cys']
P36871	PGM1	FFGNLMDASK	kidney	—	100.0	MRM	['Meth']
P36871	PGM1	FFGNLMDASK	liver	—	100.0	MRM	['Meth']
P36871	PGM1	FFGNLMDASK	lung	—	100.0	MRM	['Meth']
P36871	PGM1	FFGNLMDASK	plasma	—	100.0	MRM	['Meth']
P36871	PGM1	IDAMHGVVGPYVK	lung	—	100.0	MRM	['Meth']
P36957	DLST	LGFMSAFVK	liver	—	100.0	MRM	['Meth']
P38435	GGCX	MQLPAGEYHK	kidney	—	100.0	MRM	['Meth']
P40926	MDH2	FVFSLVDAMNGK	liver	—	100.0	MRM	['Meth']
P40926	MDH2	GYLGPEQLPDCLK	kidney	—	100.0	MRM	['Cys']
P40926	MDH2	TIIPLISQCTPK	liver	—	100.0	MRM	['Cys']
P40939	HADHA	VIGMHYFSPVDK	kidney	—	100.0	MRM	['Meth']
P40939	HADHA	VIGMHYFSPVDK	lung	—	100.0	MRM	['Meth']
P42765	ACAA2	QTMQVDEHARPQTTLEQLQK	kidney	—	100.0	MRM	['Meth']
P42765	ACAA2	QTMQVDEHARPQTTLEQLQK	liver	—	100.0	MRM	['Meth']
P46952	HAAO	LMHQEQLK	kidney	—	100.0	MRM	['Meth']
P46952	HAAO	LMHQEQLK	liver	—	100.0	MRM	['Meth']
P46977	STT3A	EGSPVLLNCLMYK	kidney	—	100.0	MRM	['Meth', 'Cys']
P47897	QARS1	NEVDMQVLHLLGPK	lung	—	100.0	MRM	['Meth']
P47989	XDH	GEAGEMELFVSTQNTMK	kidney	—	100.0	MRM	['Meth']
P47989	XDH	GEAGEMELFVSTQNTMK	liver	—	100.0	MRM	['Meth']
P47989	XDH	GEAGEMELFVSTQNTMK	lung	—	100.0	MRM	['Meth']
P47989	XDH	GLCIIPTK	liver	—	100.0	MRM	['Cys']
P48163	ME1	AECSAEQCYK	kidney	—	100.0	MRM	['Cys']
P48163	ME1	AECSAEQCYK	plasma	—	100.0	MRM	['Cys']
P48163	ME1	DMAAFNERPIIFALSNPTSK	kidney	—	100.0	MRM	['Meth']

SysQuan Core Database

Cart (0)