SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
Q07960	ARHGAP1	TLLILFK	liver	—	100.0	None	—
Q07960	ARHGAP1	TLLILFK	lung	—	100.0	None	—
Q07960	ARHGAP1	TLLILFKPLISFK	kidney	—	100.0	None	—
Q07973	CYP24A1	INPFAHLPFGVGK	kidney	—	100.0	None	—
Q08117	TLE5	HSGSSHLPQQLK	kidney	—	100.0	None	—
Q08117	TLE5	HSGSSHLPQQLK	liver	—	100.0	None	—
Q08117	TLE5	HSGSSHLPQQLK	lung	—	100.0	None	—
Q08170	SRSF4	DADDAVYELNGK	lung	—	100.0	None	—
Q08170	SRSF4	ILEVDLK	lung	—	100.0	None	—
Q08170	SRSF4	LVEDKPGSR	liver	—	100.0	None	—
Q08170	SRSF4	LVEDKPGSR	lung	—	100.0	None	—
Q08170	SRSF4	QAGEVTYADAHK	kidney	—	100.0	None	—
Q08170	SRSF4	QAGEVTYADAHK	liver	—	100.0	None	—
Q08174	PCDH1	AQVVVTVK	liver	—	100.0	None	—
Q08174	PCDH1	AQVVVTVK	lung	—	100.0	None	—
Q08174	PCDH1	DAGPNGVASYELQAGPEAQELFGLQVAEDQEEK	lung	—	100.0	None	—
Q08174	PCDH1	DLYAPKPSGK	kidney	—	100.0	None	—
Q08174	PCDH1	DLYAPKPSGK	lung	—	100.0	None	—
Q08174	PCDH1	SNSPLPSIQLQPQSPSASK	liver	—	100.0	None	—
Q08174	PCDH1	SNSPLPSIQLQPQSPSASK	lung	—	100.0	None	—
Q08174	PCDH1	YFLQTTTPLDYEK	liver	—	100.0	None	—
Q08174	PCDH1	YFLQTTTPLDYEK	lung	—	100.0	None	—
Q08209	PPP3CA	EESESVLTLK	kidney	—	100.0	None	—
Q08209	PPP3CA	HLTEYFTFK	kidney	—	100.0	None	—
Q08209	PPP3CA	HLTEYFTFK	liver	—	100.0	None	—
Q08209	PPP3CA	ITSFEEAK	lung	—	100.0	None	—
Q08209	PPP3CA	QTLQSATVEAIEADEAIK	lung	—	100.0	None	—
Q08211	DHX9	EEQEVQATLESEEVDLNAGLHGNWTLENAK	kidney	—	100.0	None	—
Q08211	DHX9	LNQYFQK	kidney	—	100.0	None	—
Q08211	DHX9	LNQYFQK	lung	—	100.0	None	—
Q08211	DHX9	YGDGPRPPK	liver	—	100.0	None	—
Q08211	DHX9	YGDGPRPPK	lung	—	100.0	None	—
Q08289	CACNB2	ALFDFLK	lung	—	100.0	None	—
Q08289	CACNB2	PVVLVGPSLK	lung	—	100.0	None	—
Q08345	DDR1	GHPLLVAVK	lung	—	100.0	None	—
Q08378	GOLGA3	EHNSILETALAK	liver	—	100.0	None	—
Q08378	GOLGA3	EHNSILETALAK	lung	—	100.0	None	—
Q08378	GOLGA3	QDSLSSEVDTLK	kidney	—	100.0	None	—
Q08378	GOLGA3	QDSLSSEVDTLK	liver	—	100.0	None	—
Q08378	GOLGA3	QDSLSSEVDTLK	lung	—	100.0	None	—
Q08378	GOLGA3	TLLQQNQQLK	lung	—	100.0	None	—
Q08426	EHHADH	GWYQYDKPLGR	kidney	—	100.0	None	—
Q08426	EHHADH	GWYQYDKPLGR	lung	—	100.0	None	—
Q08426	EHHADH	WSTPSGASWK	kidney	—	100.0	None	—
Q08426	EHHADH	WSTPSGASWK	lung	—	100.0	None	—
Q08462	ADCY2	VGINHGPVIAGVIGAQKPQYDIWGNTVNVASR	lung	—	100.0	None	—
Q08493	PDE4C	FGVQTDQEEQLAK	kidney	—	100.0	None	—
Q08493	PDE4C	FGVQTDQEEQLAK	liver	—	100.0	None	—
Q08493	PDE4C	WGLDVFK	kidney	—	100.0	None	—
Q08495	DMTN	DSSVPGSPSSIVAK	lung	—	100.0	None	—

SysQuan Core Database

Cart (0)