SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
Q06323	PSME1	NAYAVLYDIILK	liver	—	100.0	None	—
Q06323	PSME1	NAYAVLYDIILK	lung	—	100.0	None	—
Q06323	PSME1	TENLLGSYFPK	kidney	—	100.0	None	—
Q06323	PSME1	TENLLGSYFPK	liver	—	100.0	None	—
Q06323	PSME1	TENLLGSYFPK	plasma	—	100.0	None	—
Q06330	RBPJ	DGYIHYGQTVK	kidney	—	100.0	None	—
Q06330	RBPJ	DGYIHYGQTVK	lung	—	100.0	None	—
Q06330	RBPJ	GDQTVLILHAK	kidney	—	100.0	None	—
Q06330	RBPJ	GDQTVLILHAK	liver	—	100.0	None	—
Q06330	RBPJ	QTALLDADDPVSQLHK	kidney	—	100.0	None	—
Q06330	RBPJ	QTALLDADDPVSQLHK	liver	—	100.0	None	—
Q06481	APLP2	EWEEAELQAK	kidney	—	100.0	None	—
Q06481	APLP2	HYQHVLAVDPEK	liver	—	100.0	None	—
Q06481	APLP2	HYQHVLAVDPEK	lung	—	100.0	None	—
Q06481	APLP2	WEPDPTGTK	kidney	—	100.0	None	—
Q06481	APLP2	WEPDPTGTK	lung	—	100.0	None	—
Q06481	APLP2	WYFDLSK	kidney	—	100.0	None	—
Q06481	APLP2	WYFDLSK	lung	—	100.0	None	—
Q06495	SLC34A1	VAGDIFK	kidney	—	100.0	None	—
Q06546	GABPA	EAEELIEIEIDGTEK	lung	—	100.0	None	—
Q06587	RING1	SLRPDPNFDALISK	liver	—	100.0	None	—
Q06587	RING1	TTGNATVDHLSK	lung	—	100.0	None	—
Q06710	PAX8	QHYPEAYASPSHTK	kidney	—	100.0	None	—
Q06710	PAX8	YYETGSIRPGVIGGSKPK	kidney	—	100.0	None	—
Q06787	FMR1	LIQEIVDK	liver	—	100.0	None	—
Q06787	FMR1	LIQEIVDK	lung	—	100.0	None	—
Q06830	PRDX1	GLFIIDDK	kidney	—	100.0	None	—
Q06830	PRDX1	GLFIIDDK	liver	—	100.0	None	—
Q06830	PRDX1	GLFIIDDK	lung	—	100.0	None	—
Q06830	PRDX1	TIAQDYGVLK	kidney	—	100.0	None	—
Q06830	PRDX1	TIAQDYGVLK	liver	—	100.0	None	—
Q06830	PRDX1	TIAQDYGVLK	lung	—	100.0	None	—
Q07002	CDK18	ASLSDIGFGK	liver	—	100.0	None	—
Q07002	CDK18	DLKPQNLLINER	liver	—	100.0	None	—
Q07002	CDK18	LPQEFLQK	liver	—	100.0	None	—
Q07002	CDK18	LPQEFLQK	lung	—	100.0	None	—
Q07020	RPL18	APGTPHSHTKPYVR	kidney	—	100.0	None	—
Q07020	RPL18	APGTPHSHTKPYVR	liver	—	100.0	None	—
Q07020	RPL18	APGTPHSHTKPYVR	lung	—	100.0	None	—
Q07020	RPL18	TNSTFNQVVLK	lung	—	100.0	None	—
Q07021	C1QBP	GVDNTFADELVELSTALEHQEYITFLEDLK	kidney	—	100.0	None	—
Q07021	C1QBP	GVDNTFADELVELSTALEHQEYITFLEDLK	liver	—	100.0	None	—
Q07021	C1QBP	ITVTFNINNSIPPTFDGEEEPSQGQK	kidney	—	100.0	None	—
Q07065	CKAP4	DLSDGIHVVK	lung	—	100.0	None	—
Q07065	CKAP4	GAHPSGGADDVAK	kidney	—	100.0	None	—
Q07065	CKAP4	GAHPSGGADDVAK	lung	—	100.0	None	—
Q07065	CKAP4	IETNENNLESAK	liver	—	100.0	None	—
Q07065	CKAP4	LALQALTEK	liver	—	100.0	None	—
Q07065	CKAP4	LSSLDNLK	kidney	—	100.0	None	—
Q07065	CKAP4	LSSLDNLK	liver	—	100.0	None	—

SysQuan Core Database

Cart (0)