SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
P83916	CBX1	NSDEADLVPAK	dbs	—	100.0	None	—
P83916	CBX1	VEEVLEEEEEEYVVEK	liver	—	100.0	None	—
P83916	CBX1	VEEVLEEEEEEYVVEK	lung	—	100.0	None	—
P84022	SMAD3	AITTQNVNTK	lung	—	100.0	None	—
P84022	SMAD3	SSILPFTPPIVK	kidney	—	100.0	None	—
P84022	SMAD3	SSILPFTPPIVK	liver	—	100.0	None	—
P84022	SMAD3	SSILPFTPPIVK	lung	—	100.0	None	—
P84022	SMAD3	TGQLDELEK	lung	—	100.0	None	—
P84077	ARF1	GNIFANLFK	liver	—	100.0	None	—
P84077	ARF1	LGEIVTTIPTIGFNVETVEYK	liver	—	100.0	None	—
P84077	ARF1	LGEIVTTIPTIGFNVETVEYK	lung	—	100.0	None	—
P84077	ARF1	NISFTVWDVGGQDK	lung	—	100.0	None	—
P84085	ARF5	VQESADELQK	lung	—	100.0	None	—
P84090	ERH	SHTILLVQPTK	kidney	—	100.0	None	—
P84090	ERH	SHTILLVQPTK	lung	—	100.0	None	—
P84095	RHOG	EQGQAPITPQQGQALAK	liver	—	100.0	None	—
P84103	SRSF3	VYVGNLGNNGNK	kidney	—	100.0	None	—
P84103	SRSF3	VYVGNLGNNGNK	lung	—	100.0	None	—
P84157	MXRA7	EQLAAIFK	lung	—	100.0	None	—
P84243	H3-3A	SAPSTGGVK	lung	—	100.0	None	—
P85037	FOXK1	EEAPASPLRPLYPQISPLK	kidney	—	100.0	None	—
P85037	FOXK1	EEAPASPLRPLYPQISPLK	liver	—	100.0	None	—
P85037	FOXK1	EEAPASPLRPLYPQISPLK	lung	—	100.0	None	—
P85037	FOXK1	FPSTAIK	lung	—	100.0	None	—
P85037	FOXK1	IDPASEAK	lung	—	100.0	None	—
P85037	FOXK1	IQFTSLYHK	liver	—	100.0	None	—
P85037	FOXK1	QLTLSGIYAHITK	liver	—	100.0	None	—
P85037	FOXK1	QLTLSGIYAHITK	lung	—	100.0	None	—
P85299	PRR5	TELGSFFTEYLQNQLLTK	kidney	—	100.0	None	—
P86452	ZBED6	GITQALNLVDSLSLK	lung	—	100.0	None	—
P86452	ZBED6	IFLTLENVQSQK	lung	—	100.0	None	—
P86790	CCZ1B	IFVNTDDTYEELHLIVYK	kidney	—	100.0	None	—
P86790	CCZ1B	IFVNTDDTYEELHLIVYK	lung	—	100.0	None	—
P86790	CCZ1B	ILFYHPNEVEK	lung	—	100.0	None	—
P86790	CCZ1B	NANLIEVNEEVK	liver	—	100.0	None	—
P86790	CCZ1B	TFSPSKPAK	kidney	—	100.0	None	—
P98082	DAB2	DLFQVIYNVK	liver	—	100.0	None	—
P98082	DAB2	INEPPKPAPR	lung	—	100.0	None	—
P98082	DAB2	IWVNISLSGIK	kidney	—	100.0	None	—
P98082	DAB2	SSPNPFVGSPPK	liver	—	100.0	None	—
P98082	DAB2	TGQQAEPLVVDLK	kidney	—	100.0	None	—
P98082	DAB2	TGVIEHEHPVNK	lung	—	100.0	None	—
P98155	VLDLR	AIFSASIDDK	lung	—	100.0	None	—
P98155	VLDLR	FTGSELATLVNNLNDAQDIIVYHELVQPSGK	lung	—	100.0	None	—
P98155	VLDLR	LFWADLSQK	kidney	—	100.0	None	—
P98155	VLDLR	LFWADLSQK	lung	—	100.0	None	—
P98155	VLDLR	LYWLDSK	kidney	—	100.0	None	—
P98155	VLDLR	LYWLDSK	lung	—	100.0	None	—
P98155	VLDLR	NTVALDADIAAQK	lung	—	100.0	None	—
P98155	VLDLR	VYWIDGENEAVYGANK	lung	—	100.0	None	—

SysQuan Core Database

Cart (0)