SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
P55327	TPD52	ASAAFSSVGSVITK	kidney	—	100.0	None	—
P55327	TPD52	ASAAFSSVGSVITK	liver	—	100.0	None	—
P55327	TPD52	VEEEIQTLSQVLAAK	lung	—	100.0	None	—
P55345	PRMT2	VLFWDNAYEFNLSALK	lung	—	100.0	None	—
P55345	PRMT2	YHSVILQNK	lung	—	100.0	None	—
P55769	SNU13	AYPLADAHLTK	kidney	—	100.0	None	—
P55769	SNU13	AYPLADAHLTK	liver	—	100.0	None	—
P55769	SNU13	AYPLADAHLTK	lung	—	100.0	None	—
P55769	SNU13	TEADVNPK	lung	—	100.0	None	—
P55786	NPEPPS	AGIISTVEVLK	kidney	—	100.0	None	—
P55786	NPEPPS	AQELDALDNSHPIEVSVGHPSEVDEIFDAISYSK	lung	—	100.0	None	—
P55786	NPEPPS	ATFDISLVVPK	liver	—	100.0	None	—
P55786	NPEPPS	ATFDISLVVPK	lung	—	100.0	None	—
P55786	NPEPPS	DYFNVPYPLPK	lung	—	100.0	None	—
P55786	NPEPPS	FALEVAAK	liver	—	100.0	None	—
P55786	NPEPPS	FALEVAAK	lung	—	100.0	None	—
P55786	NPEPPS	IDFVGELNDK	plasma	—	100.0	None	—
P55786	NPEPPS	KPYPDDENLVEVK	kidney	—	100.0	None	—
P55786	NPEPPS	KPYPDDENLVEVK	lung	—	100.0	None	—
P55786	NPEPPS	LGWDPKPGEGHLDALLR	lung	—	100.0	None	—
P55786	NPEPPS	LSVEGFAVDK	lung	—	100.0	None	—
P55786	NPEPPS	NVKPDQWVK	kidney	—	100.0	None	—
P55786	NPEPPS	NVKPDQWVK	liver	—	100.0	None	—
P55786	NPEPPS	SPVYLTVLK	kidney	—	100.0	None	—
P55786	NPEPPS	VLTFALSEEVRPQDTVSVIGGVAGGSK	liver	—	100.0	None	—
P55786	NPEPPS	VYTPVGK	liver	—	100.0	None	—
P55809	OXCT1	DGSVAIASKPR	kidney	—	100.0	None	—
P55809	OXCT1	DGSVAIASKPR	lung	—	100.0	None	—
P55809	OXCT1	EFNGQHFILEEAITGDFALVK	kidney	—	100.0	None	—
P55809	OXCT1	EFNGQHFILEEAITGDFALVK	lung	—	100.0	None	—
P55851	UCP2	LLAGSTTGALAVAVAQPTDVVK	lung	—	100.0	None	—
P55854	SUMO3	TENDHINLK	liver	—	100.0	None	—
P55884	EIF3B	GYIFLEYASPAHAVDAVK	liver	—	100.0	None	—
P55884	EIF3B	TSIFWNDVK	lung	—	100.0	None	—
P55884	EIF3B	VNLFTDFDK	liver	—	100.0	None	—
P55884	EIF3B	VNLFTDFDK	lung	—	100.0	None	—
P56192	MARS1	AAETVLK	kidney	—	100.0	None	—
P56192	MARS1	AAETVLK	lung	—	100.0	None	—
P56192	MARS1	HGNQYIQVNEPWK	kidney	—	100.0	None	—
P56192	MARS1	HGNQYIQVNEPWK	lung	—	100.0	None	—
P56199	ITGA1	SIASEPTEK	liver	—	100.0	None	—
P56199	ITGA1	WVLIGSPLVGQPK	kidney	—	100.0	None	—
P56199	ITGA1	WVLIGSPLVGQPK	liver	—	100.0	None	—
P56199	ITGA1	WVLIGSPLVGQPK	lung	—	100.0	None	—
P56211	ARPP19	KPSLVASK	lung	—	100.0	None	—
P56211	ARPP19	SAEVPEAASAEEQK	liver	—	100.0	None	—
P56211	ARPP19	SAEVPEAASAEEQK	lung	—	100.0	None	—
P56377	AP1S2	WYVPLSDK	liver	—	100.0	None	—
P56385	ATP5ME	VPPVQVSPLIK	kidney	—	100.0	None	—
P56524	HDAC4	EQQLQQELLALK	kidney	—	100.0	None	—

SysQuan Core Database

Cart (0)