SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
P28161	GSTM2	LLLEYTDSSYEEK	lung	—	100.0	None	—
P28288	ABCD3	ALGLHGK	kidney	—	100.0	None	—
P28288	ABCD3	ALGLHGK	liver	—	100.0	None	—
P28288	ABCD3	ALGLHGK	lung	—	100.0	None	—
P28288	ABCD3	SGKPPLQNNEK	kidney	—	100.0	None	—
P28288	ABCD3	SGKPPLQNNEK	liver	—	100.0	None	—
P28288	ABCD3	YGLNELK	kidney	—	100.0	None	—
P28288	ABCD3	YGLNELK	liver	—	100.0	None	—
P28288	ABCD3	YGLNELK	lung	—	100.0	None	—
P28288	ABCD3	YLYEEYLQAFTYYK	kidney	—	100.0	None	—
P28288	ABCD3	YLYEEYLQAFTYYK	liver	—	100.0	None	—
P28288	ABCD3	YLYEEYLQAFTYYK	lung	—	100.0	None	—
P28289	TMOD1	APTGPFK	lung	—	100.0	None	—
P28289	TMOD1	EGLNSVIKPTQYKPVPDEEPNSTDVEETLER	lung	—	100.0	None	—
P28289	TMOD1	LADLTGPIIPK	kidney	—	100.0	None	—
P28289	TMOD1	LADLTGPIIPK	liver	—	100.0	None	—
P28289	TMOD1	PTQYKPVPDEEPNSTDVEETLER	lung	—	100.0	None	—
P28290	ITPRID2	EIVSGLLAAVSSSK	liver	—	100.0	None	—
P28290	ITPRID2	EIVSGLLAAVSSSK	lung	—	100.0	None	—
P28328	PEX2	ISQLDALELNK	liver	—	100.0	None	—
P28328	PEX2	ISQLDALELNK	lung	—	100.0	None	—
P28330	ACADL	LETPSAK	liver	—	100.0	None	—
P28331	NDUFS1	FAYDGLK	liver	—	100.0	None	—
P28331	NDUFS1	FAYDGLK	lung	—	100.0	None	—
P28331	NDUFS1	NIGPLVK	liver	—	100.0	None	—
P28331	NDUFS1	NIGPLVK	lung	—	100.0	None	—
P28331	NDUFS1	SWLHNDLK	liver	—	100.0	None	—
P28340	POLD1	IDISQLVITK	liver	—	100.0	None	—
P28340	POLD1	TPTGDEFVK	lung	—	100.0	None	—
P28347	TEAD1	GPQNAFFLVK	kidney	—	100.0	None	—
P28347	TEAD1	IILSDEGK	lung	—	100.0	None	—
P28482	MAPK1	ALDLLDK	lung	—	100.0	None	—
P28482	MAPK1	IEVEQALAHPYLEQYYDPSDEPIAEAPFK	lung	—	100.0	None	—
P28482	MAPK1	LFPNADSK	lung	—	100.0	None	—
P28482	MAPK1	NYLLSLPHK	kidney	—	100.0	None	—
P28482	MAPK1	NYLLSLPHK	lung	—	100.0	None	—
P28482	MAPK1	NYLLSLPHK	plasma	—	100.0	None	—
P28702	RXRB	AIILFNPDAK	lung	—	100.0	None	—
P28702	RXRB	ILEAELAVEQK	kidney	—	100.0	None	—
P28702	RXRB	ILEAELAVEQK	liver	—	100.0	None	—
P28702	RXRB	ILEAELAVEQK	lung	—	100.0	None	—
P28702	RXRB	VLTELVSK	liver	—	100.0	None	—
P28702	RXRB	VLTELVSK	lung	—	100.0	None	—
P28715	ERCC5	IRPIFVFDGDAPLLK	kidney	—	100.0	None	—
P28715	ERCC5	IRPIFVFDGDAPLLK	lung	—	100.0	None	—
P28715	ERCC5	VVSEDTSHYILIK	liver	—	100.0	None	—
P28827	PTPRM	AHLLLPQLK	lung	—	100.0	None	—
P28827	PTPRM	QPSAFIVTQHPLPNTVK	lung	—	100.0	None	—
P28827	PTPRM	TVDVFHAVK	lung	—	100.0	None	—
P29083	GTF2E1	ADPDVLTEVPAALK	liver	—	100.0	None	—

SysQuan Core Database

Cart (0)