SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
P18583	SON	SGGATIEELTEK	kidney	—	100.0	None	—
P18583	SON	SGGATIEELTEK	liver	—	100.0	None	—
P18583	SON	SGGATIEELTEK	lung	—	100.0	None	—
P18583	SON	SLPNEEIVQK	liver	—	100.0	None	—
P18615	NELFE	SVWGSLAVQNSPK	lung	—	100.0	None	—
P18621	RPL17	EQIVPKPEEEVAQK	kidney	—	100.0	None	—
P18621	RPL17	EQIVPKPEEEVAQK	liver	—	100.0	None	—
P18621	RPL17	EQIVPKPEEEVAQK	lung	—	100.0	None	—
P18621	RPL17	GLDVDSLVIEHIQVNK	liver	—	100.0	None	—
P18621	RPL17	YSLDPENPTK	liver	—	100.0	None	—
P18827	SDC1	DEGSYSLEEPK	lung	—	100.0	None	—
P18858	LIG1	TLDVDATYEIAK	kidney	—	100.0	None	—
P18858	LIG1	TLDVDATYEIAK	lung	—	100.0	None	—
P19021	PAM	GDHVWDGNSFDSK	kidney	—	100.0	None	—
P19021	PAM	IVQFSPSGK	lung	—	100.0	None	—
P19021	PAM	IVQFSPSGK	plasma	—	100.0	None	—
P19022	CDH2	FLEAGIYEVPIIITDSGNPPK	kidney	—	100.0	None	—
P19022	CDH2	FLEAGIYEVPIIITDSGNPPK	lung	—	100.0	None	—
P19022	CDH2	FLEAGIYEVPIIITDSGNPPK	plasma	—	100.0	None	—
P19022	CDH2	LSDPANWLK	liver	—	100.0	None	—
P19022	CDH2	LSDPANWLK	lung	—	100.0	None	—
P19022	CDH2	SAAPHPGDIGDFINEGLK	kidney	—	100.0	None	—
P19022	CDH2	YDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIR	liver	—	100.0	None	—
P19022	CDH2	YDEEGGGEEDQDYDLSQLQQPDTVEPDAIKPVGIR	lung	—	100.0	None	—
P19022	CDH2	YSVTGPGADQPPTGIFIINPISGQLSVTKPLDR	liver	—	100.0	None	—
P19086	GNAZ	EYKPLIIYNAIDSLTR	kidney	—	100.0	None	—
P19086	GNAZ	EYKPLIIYNAIDSLTR	lung	—	100.0	None	—
P19086	GNAZ	LLLLGTSNSGK	lung	—	100.0	None	—
P19086	GNAZ	LLLLGTSNSGK	plasma	—	100.0	None	—
P19174	PLCG1	DEAFDPFDK	liver	—	100.0	None	—
P19174	PLCG1	FSDVLHTIK	liver	—	100.0	None	—
P19174	PLCG1	IDIFPAK	lung	—	100.0	None	—
P19174	PLCG1	IYYSEETSSDQGNEDEEEPK	kidney	—	100.0	None	—
P19174	PLCG1	IYYSEETSSDQGNEDEEEPK	liver	—	100.0	None	—
P19174	PLCG1	IYYSEETSSDQGNEDEEEPK	lung	—	100.0	None	—
P19174	PLCG1	LSEPVPQTNAHESK	kidney	—	100.0	None	—
P19174	PLCG1	LSEPVPQTNAHESK	liver	—	100.0	None	—
P19174	PLCG1	LSEPVPQTNAHESK	lung	—	100.0	None	—
P19174	PLCG1	NNYSEDLELASLLIK	lung	—	100.0	None	—
P19174	PLCG1	SAIIQNVEK	lung	—	100.0	None	—
P19174	PLCG1	YPINEEALEK	liver	—	100.0	None	—
P19320	VCAM1	GSYSLVEAQK	plasma	—	100.0	None	—
P19320	VCAM1	SLEVTFTPVIEDIGK	liver	—	100.0	None	—
P19320	VCAM1	SLEVTFTPVIEDIGK	lung	—	100.0	None	—
P19338	NCL	FGYVDFESAEDLEK	kidney	—	100.0	None	—
P19338	NCL	FGYVDFESAEDLEK	lung	—	100.0	None	—
P19338	NCL	GFGFVDFNSEEDAK	liver	—	100.0	None	—
P19338	NCL	GLSEDTTEETLK	lung	—	100.0	None	—
P19338	NCL	VFGNEIK	liver	—	100.0	None	—
P19338	NCL	VTLDWAK	lung	—	100.0	None	—

SysQuan Core Database

Cart (0)