SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
P06737	PYGL	YEYGIFNQK	lung	—	100.0	None	—
P06744	GPI	PTNSIVFTK	liver	—	100.0	None	—
P06744	GPI	VFEGNRPTNSIVFTK	dbs	—	100.0	None	—
P06744	GPI	VFEGNRPTNSIVFTK	kidney	—	100.0	None	—
P06744	GPI	VFEGNRPTNSIVFTK	plasma	—	100.0	None	—
P06746	POLB	FVDEGIK	kidney	—	100.0	None	—
P06746	POLB	IDEFLATGK	liver	—	100.0	None	—
P06746	POLB	IDEFLATGK	lung	—	100.0	None	—
P06746	POLB	VHFITDTLSK	kidney	—	100.0	None	—
P06746	POLB	VHFITDTLSK	lung	—	100.0	None	—
P06753	TPM3	LATALQK	plasma	—	100.0	None	—
P06753	TPM3	SLEAQAEK	liver	—	100.0	None	—
P06756	ITGAV	DDPLEFK	lung	—	100.0	None	—
P06756	ITGAV	FGSAIAPLGDLDQDGFNDIAIAAPYGGEDK	kidney	—	100.0	None	—
P06756	ITGAV	FGSAIAPLGDLDQDGFNDIAIAAPYGGEDK	lung	—	100.0	None	—
P06756	ITGAV	SAILYVK	liver	—	100.0	None	—
P06756	ITGAV	SAILYVK	lung	—	100.0	None	—
P06858	LPL	GLGDVDQLVK	lung	—	100.0	None	—
P06858	LPL	GLGDVDQLVK	plasma	—	100.0	None	—
P06858	LPL	SIHLFIDSLLNEENPSK	plasma	—	100.0	None	—
P06858	LPL	VFHYQVK	kidney	—	100.0	None	—
P06858	LPL	VFHYQVK	lung	—	100.0	None	—
P06858	LPL	VFHYQVK	plasma	—	100.0	None	—
P06865	HEXA	GYVVWQEVFDNK	lung	—	100.0	None	—
P07093	SERPINE2	IEVSEDGTK	lung	—	100.0	None	—
P07093	SERPINE2	IEVSEDGTK	plasma	—	100.0	None	—
P07093	SERPINE2	LVLVNAVYFK	kidney	—	100.0	None	—
P07099	EPHX1	IIPLLTDPK	liver	—	100.0	None	—
P07099	EPHX1	IIPLLTDPK	lung	—	100.0	None	—
P07195	LDHB	DYSVTANSK	plasma	—	100.0	None	—
P07195	LDHB	FIIPQIVK	plasma	—	100.0	None	—
P07195	LDHB	GLTSVINQK	kidney	—	100.0	None	—
P07195	LDHB	GLTSVINQK	plasma	—	100.0	None	—
P07195	LDHB	SLADELALVDVLEDK	plasma	—	100.0	None	—
P07196	NEFL	FTVLTESAAK	lung	—	100.0	None	—
P07237	P4HB	ALAPEYAK	kidney	—	100.0	None	—
P07237	P4HB	ALAPEYAK	liver	—	100.0	None	—
P07237	P4HB	ALAPEYAK	plasma	—	100.0	None	—
P07237	P4HB	DGVVLFK	liver	—	100.0	None	—
P07237	P4HB	DGVVLFK	lung	—	100.0	None	—
P07237	P4HB	EADDIVNWLK	lung	—	100.0	None	—
P07237	P4HB	HNQLPLVIEFTEQTAPK	kidney	—	100.0	None	—
P07237	P4HB	HNQLPLVIEFTEQTAPK	liver	—	100.0	None	—
P07237	P4HB	ILEFFGLK	plasma	—	100.0	None	—
P07237	P4HB	SVSDYDGK	lung	—	100.0	None	—
P07237	P4HB	THILLFLPK	plasma	—	100.0	None	—
P07237	P4HB	VHSFPTLK	liver	—	100.0	None	—
P07237	P4HB	VHSFPTLK	lung	—	100.0	None	—
P07305	H1-0	TENSTSAPAAK	lung	—	100.0	None	—
P07305	H1-0	TENSTSAPAAKPK	kidney	—	100.0	None	—

SysQuan Core Database

Cart (0)