SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
P05455	SSB	PLPEVTDEYK	lung	—	100.0	None	—
P05546	SERPIND1	IAIDLFK	kidney	—	100.0	None	—
P05546	SERPIND1	IAIDLFK	liver	—	100.0	None	—
P05546	SERPIND1	IAIDLFK	plasma	—	100.0	None	—
P05546	SERPIND1	LNILNAK	kidney	—	100.0	None	—
P05556	ITGB1	DNTNEIYSGK	lung	—	100.0	None	—
P05556	ITGB1	DNTNEIYSGK	plasma	—	100.0	None	—
P05556	ITGB1	IGFGSFVEK	kidney	—	100.0	None	—
P05556	ITGB1	IGFGSFVEK	plasma	—	100.0	None	—
P05556	ITGB1	LLVFSTDAGFHFAGDGK	lung	—	100.0	None	—
P05556	ITGB1	LSENNIQTIFAVTEEFQPVYK	dbs	—	100.0	None	—
P05556	ITGB1	LSENNIQTIFAVTEEFQPVYK	kidney	—	100.0	None	—
P05556	ITGB1	LSENNIQTIFAVTEEFQPVYK	lung	—	100.0	None	—
P05556	ITGB1	LSENNIQTIFAVTEEFQPVYK	plasma	—	100.0	None	—
P05556	ITGB1	SAVTTVVNPK	liver	—	100.0	None	—
P05556	ITGB1	SAVTTVVNPK	plasma	—	100.0	None	—
P05556	ITGB1	WDTGENPIYK	plasma	—	100.0	None	—
P05771	PRKCB	ENIWDGVTTK	kidney	—	100.0	None	—
P05783	KRT18	LQLETEIEALK	kidney	—	100.0	None	—
P05783	KRT18	LQLETEIEALK	lung	—	100.0	None	—
P05937	CALB1	AFELYDQDGNGYIDENELDALLK	kidney	—	100.0	None	—
P05976	MYL1	IDLSAIK	lung	—	100.0	None	—
P06132	UROD	DGHFALEELAQAGYEVVGLDWTVAPK	kidney	—	100.0	None	—
P06133	UGT2B4	IHHDQPVKPLDR	liver	—	100.0	None	—
P06213	INSR	ILDSVEDNYIVLNK	liver	—	100.0	None	—
P06213	INSR	ILDSVEDNYIVLNK	lung	—	100.0	None	—
P06213	INSR	LFFHYNPK	kidney	—	100.0	None	—
P06213	INSR	LFFHYNPK	lung	—	100.0	None	—
P06213	INSR	LLGVVSK	kidney	—	100.0	None	—
P06213	INSR	LLGVVSK	lung	—	100.0	None	—
P06213	INSR	QLWDWSK	lung	—	100.0	None	—
P06213	INSR	VYGLESLK	liver	—	100.0	None	—
P06239	LCK	DFDQNQGEVVK	lung	—	100.0	None	—
P06241	FYN	ESLQLIK	lung	—	100.0	None	—
P06241	FYN	LTDLSVK	liver	—	100.0	None	—
P06241	FYN	LTDLSVK	lung	—	100.0	None	—
P06241	FYN	SLTTGETGYIPSNYVAPVDSIQAEEWYFGK	lung	—	100.0	None	—
P06241	FYN	TEDDLSFHK	liver	—	100.0	None	—
P06241	FYN	TEDDLSFHK	lung	—	100.0	None	—
P06276	BCHE	NIAAFGGNPK	lung	—	100.0	None	—
P06276	BCHE	NIAAFGGNPK	plasma	—	100.0	None	—
P06312	IGKV4-1	NYLAWYQQKPGQPPK	plasma	—	100.0	None	—
P06396	GSN	QTQVSVLPEGGETPLFK	kidney	—	100.0	None	—
P06396	GSN	QTQVSVLPEGGETPLFK	lung	—	100.0	None	—
P06396	GSN	QTQVSVLPEGGETPLFK	plasma	—	100.0	None	—
P06396	GSN	TPSAAYLWVGTGASEAEK	dbs	—	100.0	None	—
P06400	RB1	IIVTAYK	lung	—	100.0	None	—
P06400	RB1	ISEGLPTPTK	kidney	—	100.0	None	—
P06400	RB1	LSIQNFSK	kidney	—	100.0	None	—
P06493	CDK1	ALGTPNNEVWPEVESLQDYK	kidney	—	100.0	None	—

SysQuan Core Database

Cart (0)