SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
O75970	MPDZ	NDTGVFVSDIVK	liver	—	100.0	None	—
O75970	MPDZ	NDTGVFVSDIVK	lung	—	100.0	None	—
O75970	MPDZ	SHQNASSIIK	lung	—	100.0	None	—
O75970	MPDZ	SVLPEGPVGHSGK	kidney	—	100.0	None	—
O75970	MPDZ	SVLPEGPVGHSGK	lung	—	100.0	None	—
O75976	CPD	AIIENLIQK	liver	—	100.0	None	—
O75976	CPD	AVIVLNEGIK	liver	—	100.0	None	—
O75976	CPD	AVIVLNEGIK	lung	—	100.0	None	—
O75976	CPD	ESLITLIEK	liver	—	100.0	None	—
O75976	CPD	ESLITLIEK	plasma	—	100.0	None	—
O75976	CPD	FVLSGNLHGGSVVASYPFDDSPEHK	kidney	—	100.0	None	—
O75976	CPD	FVLSGNLHGGSVVASYPFDDSPEHK	lung	—	100.0	None	—
O75976	CPD	GYNPVTK	kidney	—	100.0	None	—
O75976	CPD	LLVPGTYK	lung	—	100.0	None	—
O75976	CPD	SLLSHEFQDETDTEEETLYSSK	kidney	—	100.0	None	—
O75995	SASH3	LLTAAELLLDYDTGSEEAEEGAESSQEPVAHTVSEPK	lung	—	100.0	None	—
O75995	SASH3	SKPSSPVVSEK	lung	—	100.0	None	—
O75995	SASH3	VHTDFTPSPYDHDSLK	kidney	—	100.0	None	—
O76003	GLRX3	YEISSVPTFLFFK	liver	—	100.0	None	—
O76024	WFS1	WPVFELK	liver	—	100.0	None	—
O76024	WFS1	WPVFELK	lung	—	100.0	None	—
O76031	CLPX	DVGGEGVQQGLLK	liver	—	100.0	None	—
O76031	CLPX	IYNYLDK	kidney	—	100.0	None	—
O76031	CLPX	LAFQQKPPPPPK	kidney	—	100.0	None	—
O76031	CLPX	LAFQQKPPPPPK	liver	—	100.0	None	—
O76031	CLPX	LAFQQKPPPPPK	lung	—	100.0	None	—
O76031	CLPX	LLQDANYNVEK	kidney	—	100.0	None	—
O76031	CLPX	LPVVVPLHSLDEK	kidney	—	100.0	None	—
O76031	CLPX	LPVVVPLHSLDEK	liver	—	100.0	None	—
O76031	CLPX	LPVVVPLHSLDEK	lung	—	100.0	None	—
O76031	CLPX	SGESNTHQDIEEK	kidney	—	100.0	None	—
O76031	CLPX	SGESNTHQDIEEK	liver	—	100.0	None	—
O76031	CLPX	VLSVAVYNHYK	kidney	—	100.0	None	—
O76031	CLPX	VLSVAVYNHYK	liver	—	100.0	None	—
O76031	CLPX	YVVGQSFAK	liver	—	100.0	None	—
O76031	CLPX	YVVGQSFAK	lung	—	100.0	None	—
O76039	CDKL5	DIKPENLLISHNDVLK	lung	—	100.0	None	—
O76039	CDKL5	DLTNNNIPHLLSPK	lung	—	100.0	None	—
O76039	CDKL5	FEILGVVGEGAYGVVLK	lung	—	100.0	None	—
O76039	CDKL5	QENIVELK	lung	—	100.0	None	—
O76039	CDKL5	SEGGVYHDPHSDDGTAPK	lung	—	100.0	None	—
O76039	CDKL5	SPELLLGAPYGK	lung	—	100.0	None	—
O76054	SEC14L2	FDNTYSFIHAK	kidney	—	100.0	None	—
O76054	SEC14L2	FDNTYSFIHAK	liver	—	100.0	None	—
O76054	SEC14L2	FDNTYSFIHAK	lung	—	100.0	None	—
O76054	SEC14L2	GLLFSASK	kidney	—	100.0	None	—
O76054	SEC14L2	GLLFSASK	liver	—	100.0	None	—
O76054	SEC14L2	LFPVAYNLIKPFLSEDTR	kidney	—	100.0	None	—
O76054	SEC14L2	LFPVAYNLIKPFLSEDTR	liver	—	100.0	None	—
O76070	SNCG	EGVVGAVEK	kidney	—	100.0	None	—

SysQuan Core Database

Cart (0)