SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
O75643	SNRNP200	IASHYYITNDTVQTYNQLLKPTLSEIELFR	kidney	—	100.0	None	—
O75643	SNRNP200	IASHYYITNDTVQTYNQLLKPTLSEIELFR	liver	—	100.0	None	—
O75643	SNRNP200	IVALSSSLSNAK	kidney	—	100.0	None	—
O75643	SNRNP200	IVALSSSLSNAK	lung	—	100.0	None	—
O75643	SNRNP200	KPVIVFVPSR	kidney	—	100.0	None	—
O75643	SNRNP200	KPVIVFVPSR	lung	—	100.0	None	—
O75643	SNRNP200	LSDSTLK	lung	—	100.0	None	—
O75643	SNRNP200	NSAFESLYQDK	liver	—	100.0	None	—
O75643	SNRNP200	PFGSEEQLLPVEK	kidney	—	100.0	None	—
O75643	SNRNP200	PKPFGSEEQLLPVEK	liver	—	100.0	None	—
O75643	SNRNP200	PVPLEQTYVGITEK	liver	—	100.0	None	—
O75643	SNRNP200	PVYHAITK	kidney	—	100.0	None	—
O75643	SNRNP200	PVYHAITK	liver	—	100.0	None	—
O75643	SNRNP200	PVYHAITK	lung	—	100.0	None	—
O75643	SNRNP200	QLPHFTSEHIK	lung	—	100.0	None	—
O75643	SNRNP200	SPTLYGISHDDLK	lung	—	100.0	None	—
O75643	SNRNP200	VELTITPDFQWDEK	lung	—	100.0	None	—
O75643	SNRNP200	VFSLSSEFK	lung	—	100.0	None	—
O75643	SNRNP200	VVLLTGETSTDLK	kidney	—	100.0	None	—
O75643	SNRNP200	VVLLTGETSTDLK	lung	—	100.0	None	—
O75643	SNRNP200	YHVLVNLGK	kidney	—	100.0	None	—
O75643	SNRNP200	YHVLVNLGK	lung	—	100.0	None	—
O75643	SNRNP200	YPNIELSYEVVDK	kidney	—	100.0	None	—
O75648	TRMU	LLQAADSFK	liver	—	100.0	None	—
O75648	TRMU	TSLEDEEVFEQK	lung	—	100.0	None	—
O75663	TIPRL	EVIKPYDWTYTTDYK	kidney	—	100.0	None	—
O75663	TIPRL	EVIKPYDWTYTTDYK	liver	—	100.0	None	—
O75663	TIPRL	EVIKPYDWTYTTDYK	lung	—	100.0	None	—
O75663	TIPRL	FFEEVLLFEDELHDHGVSSLSVK	dbs	—	100.0	None	—
O75663	TIPRL	GTLLGESLK	kidney	—	100.0	None	—
O75663	TIPRL	GTLLGESLK	liver	—	100.0	None	—
O75663	TIPRL	VVPTTDHIDTEK	kidney	—	100.0	None	—
O75674	TOM1L1	DPYATSVGHLIEK	liver	—	100.0	None	—
O75676	RPS6KA4	DLKPENILYADDTPGAPVK	kidney	—	100.0	None	—
O75676	RPS6KA4	DLKPENILYADDTPGAPVK	liver	—	100.0	None	—
O75676	RPS6KA4	DLKPENILYADDTPGAPVK	lung	—	100.0	None	—
O75676	RPS6KA4	EFLTEEK	kidney	—	100.0	None	—
O75676	RPS6KA4	EFLTEEK	lung	—	100.0	None	—
O75676	RPS6KA4	LENVLLDSEGHIVLTDFGLSK	kidney	—	100.0	None	—
O75676	RPS6KA4	LENVLLDSEGHIVLTDFGLSK	lung	—	100.0	None	—
O75676	RPS6KA4	QSGQEFAVK	kidney	—	100.0	None	—
O75676	RPS6KA4	QSGQEFAVK	lung	—	100.0	None	—
O75676	RPS6KA4	VYGGEIVLALEHLHK	kidney	—	100.0	None	—
O75683	SURF6	LLQEALK	liver	—	100.0	None	—
O75683	SURF6	LLQEALK	lung	—	100.0	None	—
O75683	SURF6	WTNLLYK	kidney	—	100.0	None	—
O75683	SURF6	WTNLLYK	lung	—	100.0	None	—
O75688	PPM1B	ALGDYDYK	lung	—	100.0	None	—
O75688	PPM1B	ILSAENIPNLPPGGGLAGK	kidney	—	100.0	None	—
O75688	PPM1B	ILSAENIPNLPPGGGLAGK	lung	—	100.0	None	—

SysQuan Core Database

Cart (0)