SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
O15484	CAPN5	VLFEDPLFPATDDSLYYK	plasma	—	100.0	None	—
O15484	CAPN5	YFTDIIK	kidney	—	100.0	None	—
O15484	CAPN5	YFTDIIK	lung	—	100.0	None	—
O15498	YKT6	VAFTLLEK	liver	—	100.0	None	—
O15498	YKT6	VQAELDETK	lung	—	100.0	None	—
O15504	NUP42	KPNISGFTDISPEELR	lung	—	100.0	None	—
O15511	ARPC5	AVQSLDK	lung	—	100.0	None	—
O15511	ARPC5	VDVDEYDENK	lung	—	100.0	None	—
O15514	POLR2D	AGDVEEDASQLIFPK	kidney	—	100.0	None	—
O15514	POLR2D	AGDVEEDASQLIFPK	liver	—	100.0	None	—
O15514	POLR2D	FEDEELQQILDDIQTK	liver	—	100.0	None	—
O15514	POLR2D	FEDEELQQILDDIQTK	lung	—	100.0	None	—
O15516	CLOCK	ELGIEESLPETAADK	kidney	—	100.0	None	—
O15516	CLOCK	ELGIEESLPETAADK	liver	—	100.0	None	—
O15516	CLOCK	ELGIEESLPETAADK	lung	—	100.0	None	—
O15516	CLOCK	ILSTHLLESDSLTPEYLK	kidney	—	100.0	None	—
O15516	CLOCK	ILSTHLLESDSLTPEYLK	liver	—	100.0	None	—
O15516	CLOCK	ILSTHLLESDSLTPEYLK	lung	—	100.0	None	—
O15516	CLOCK	INTVSLK	liver	—	100.0	None	—
O15516	CLOCK	LATPQFIK	lung	—	100.0	None	—
O15525	MAFG	AELQQEVEK	lung	—	100.0	None	—
O15525	MAFG	GPLAAGLGPLVPGK	liver	—	100.0	None	—
O15525	MAFG	GPLAAGLGPLVPGK	lung	—	100.0	None	—
O15525	MAFG	VAATSVITIVK	lung	—	100.0	None	—
O15530	PDPK1	ANSFVGTAQYVSPELLTEK	kidney	—	100.0	None	—
O15530	PDPK1	ANSFVGTAQYVSPELLTEK	lung	—	100.0	None	—
O15530	PDPK1	FYTAEIVSALEYLHGK	kidney	—	100.0	None	—
O15530	PDPK1	FYTAEIVSALEYLHGK	liver	—	100.0	None	—
O15530	PDPK1	FYTAEIVSALEYLHGK	lung	—	100.0	None	—
O15530	PDPK1	GEIPWSQELRPEAK	liver	—	100.0	None	—
O15530	PDPK1	GEIPWSQELRPEAK	lung	—	100.0	None	—
O15530	PDPK1	LDHPFFVK	lung	—	100.0	None	—
O15530	PDPK1	LLVLDATK	lung	—	100.0	None	—
O15530	PDPK1	LYFGLSYAK	kidney	—	100.0	None	—
O15530	PDPK1	LYFGLSYAK	lung	—	100.0	None	—
O15530	PDPK1	LYFTFQDDEK	lung	—	100.0	None	—
O15530	PDPK1	QAGGNPWHQFVENNLILK	lung	—	100.0	None	—
O15530	PDPK1	QLLLTEGPHLYYVDPVNK	kidney	—	100.0	None	—
O15530	PDPK1	QLLLTEGPHLYYVDPVNK	liver	—	100.0	None	—
O15541	RNF113A	YGVYEDENYEVGSDDEEIPFK	kidney	—	100.0	None	—
O15550	KDM6A	EAYEQLLQTENLSAQVK	kidney	—	100.0	None	—
O15550	KDM6A	EAYEQLLQTENLSAQVK	lung	—	100.0	None	—
O15550	KDM6A	GLAGALK	kidney	—	100.0	None	—
O15550	KDM6A	LDLGLFSTK	liver	—	100.0	None	—
O15550	KDM6A	LQLHELTK	kidney	—	100.0	None	—
O15550	KDM6A	LQLHELTK	lung	—	100.0	None	—
O15550	KDM6A	NQLSNSTQGLHK	kidney	—	100.0	None	—
O15550	KDM6A	NQLSNSTQGLHK	lung	—	100.0	None	—
O15550	KDM6A	VNTDYESSLK	kidney	—	100.0	None	—
O43143	DHX15	DNQVVQLHPSTVLDHKPEWVLYNEFVLTTK	kidney	—	100.0	None	—

SysQuan Core Database

Cart (0)