SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
O15357	INPPL1	VAVLVKPEHENR	kidney	—	100.0	None	—
O15357	INPPL1	VAVLVKPEHENR	liver	—	100.0	None	—
O15357	INPPL1	VAVLVKPEHENR	lung	—	100.0	None	—
O15371	EIF3D	GAVIATELK	kidney	—	100.0	None	—
O15371	EIF3D	HVILGTQQFK	kidney	—	100.0	None	—
O15371	EIF3D	HVILGTQQFK	liver	—	100.0	None	—
O15371	EIF3D	HVILGTQQFKPNEFASQINLSVENAWGILR	kidney	—	100.0	None	—
O15371	EIF3D	VADWTGATYQDK	lung	—	100.0	None	—
O15372	EIF3H	ALLDSQFSYQHAIEESVVLIYDPIK	kidney	—	100.0	None	—
O15372	EIF3H	ALLDSQFSYQHAIEESVVLIYDPIK	lung	—	100.0	None	—
O15372	EIF3H	DFSPEALK	kidney	—	100.0	None	—
O15372	EIF3H	GEPPLPEEDLSK	dbs	—	100.0	None	—
O15372	EIF3H	HELLSLASSNHLGK	lung	—	100.0	None	—
O15372	EIF3H	TAQGSLSLK	lung	—	100.0	None	—
O15379	HDAC3	QTIFENLK	kidney	—	100.0	None	—
O15379	HDAC3	QTIFENLK	lung	—	100.0	None	—
O15379	HDAC3	YTGASLQGATQLNNK	liver	—	100.0	None	—
O15381	NVL	AVANESGLNFISVK	lung	—	100.0	None	—
O15381	NVL	TLLAHAIAGELDLPILK	kidney	—	100.0	None	—
O15381	NVL	TLLAHAIAGELDLPILK	lung	—	100.0	None	—
O15381	NVL	VAAPEIVSGVSGESEQK	kidney	—	100.0	None	—
O15381	NVL	VAAPEIVSGVSGESEQK	liver	—	100.0	None	—
O15381	NVL	VAAPEIVSGVSGESEQK	lung	—	100.0	None	—
O15393	TMPRSS2	VISHPNYDSK	kidney	—	100.0	None	—
O15397	IPO8	ETENDDVTNVIQK	lung	—	100.0	None	—
O15397	IPO8	IIDLVLQK	kidney	—	100.0	None	—
O15397	IPO8	IIDLVLQK	liver	—	100.0	None	—
O15397	IPO8	IIDLVLQK	lung	—	100.0	None	—
O15397	IPO8	TYAVGIQQVLLK	kidney	—	100.0	None	—
O15397	IPO8	TYAVGIQQVLLK	lung	—	100.0	None	—
O15400	STX7	LVAEFTTSLTNFQK	kidney	—	100.0	None	—
O15400	STX7	LVAEFTTSLTNFQK	liver	—	100.0	None	—
O15400	STX7	LVAEFTTSLTNFQK	lung	—	100.0	None	—
O15403	SLC16A6	TSIDSIDSGVELTTSPK	kidney	—	100.0	None	—
O15427	SLC16A3	EVEHFLK	lung	—	100.0	None	—
O15439	ABCC4	GTYTEFLK	kidney	—	100.0	None	—
O15439	ABCC4	HLTALIK	kidney	—	100.0	None	—
O15439	ABCC4	HLTALIK	lung	—	100.0	None	—
O15439	ABCC4	ITILVTHQLQYLK	lung	—	100.0	None	—
O15439	ABCC4	LNTIIDSDK	kidney	—	100.0	None	—
O15439	ABCC4	PGELLAVVGPVGAGK	kidney	—	100.0	None	—
O15439	ABCC4	VIEYTDLEK	lung	—	100.0	None	—
O15440	ABCC5	GHLLLDSDERPSPEEEEGK	kidney	—	100.0	None	—
O15440	ABCC5	GHLLLDSDERPSPEEEEGK	lung	—	100.0	None	—
O15455	TLR3	NLITSVEK	lung	—	100.0	None	—
O15484	CAPN5	GGLISASIK	lung	—	100.0	None	—
O15484	CAPN5	LGHGLLAFFK	kidney	—	100.0	None	—
O15484	CAPN5	VLFEDPLFPATDDSLYYK	kidney	—	100.0	None	—
O15484	CAPN5	VLFEDPLFPATDDSLYYK	liver	—	100.0	None	—
O15484	CAPN5	VLFEDPLFPATDDSLYYK	lung	—	100.0	None	—

SysQuan Core Database

Cart (0)