SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
O15525	MAFG	AELQQEVEK	lung	—	100.0	None	—
O15525	MAFG	GPLAAGLGPLVPGK	liver	—	100.0	None	—
O15525	MAFG	GPLAAGLGPLVPGK	lung	—	100.0	None	—
O15525	MAFG	VAATSVITIVK	lung	—	100.0	None	—
O15530	PDPK1	ANSFVGTAQYVSPELLTEK	kidney	—	100.0	None	—
O15530	PDPK1	ANSFVGTAQYVSPELLTEK	lung	—	100.0	None	—
O15530	PDPK1	FYTAEIVSALEYLHGK	kidney	—	100.0	None	—
O15530	PDPK1	FYTAEIVSALEYLHGK	liver	—	100.0	None	—
O15530	PDPK1	FYTAEIVSALEYLHGK	lung	—	100.0	None	—
O15530	PDPK1	GEIPWSQELRPEAK	liver	—	100.0	None	—
O15530	PDPK1	GEIPWSQELRPEAK	lung	—	100.0	None	—
O15530	PDPK1	LDHPFFVK	lung	—	100.0	None	—
O15530	PDPK1	LLVLDATK	lung	—	100.0	None	—
O15530	PDPK1	LYFGLSYAK	kidney	—	100.0	None	—
O15530	PDPK1	LYFGLSYAK	lung	—	100.0	None	—
O15530	PDPK1	LYFTFQDDEK	lung	—	100.0	None	—
O15530	PDPK1	QAGGNPWHQFVENNLILK	lung	—	100.0	None	—
O15530	PDPK1	QLLLTEGPHLYYVDPVNK	kidney	—	100.0	None	—
O15530	PDPK1	QLLLTEGPHLYYVDPVNK	liver	—	100.0	None	—
O15541	RNF113A	YGVYEDENYEVGSDDEEIPFK	kidney	—	100.0	None	—
O15550	KDM6A	EAYEQLLQTENLSAQVK	kidney	—	100.0	None	—
O15550	KDM6A	EAYEQLLQTENLSAQVK	lung	—	100.0	None	—
O15550	KDM6A	GLAGALK	kidney	—	100.0	None	—
O15550	KDM6A	LDLGLFSTK	liver	—	100.0	None	—
O15550	KDM6A	LQLHELTK	kidney	—	100.0	None	—
O15550	KDM6A	LQLHELTK	lung	—	100.0	None	—
O15550	KDM6A	NQLSNSTQGLHK	kidney	—	100.0	None	—
O15550	KDM6A	NQLSNSTQGLHK	lung	—	100.0	None	—
O15550	KDM6A	VNTDYESSLK	kidney	—	100.0	None	—
O43143	DHX15	DNQVVQLHPSTVLDHKPEWVLYNEFVLTTK	kidney	—	100.0	None	—
O43143	DHX15	EVDDLGPEVGDIK	kidney	—	100.0	None	—
O43143	DHX15	FAHIDGDHLTLLNVYHAFK	kidney	—	100.0	None	—
O43143	DHX15	FAHIDGDHLTLLNVYHAFK	lung	—	100.0	None	—
O43143	DHX15	HQSFVLVGETGSGK	kidney	—	100.0	None	—
O43143	DHX15	IFEPPPPK	kidney	—	100.0	None	—
O43143	DHX15	IFEPPPPK	liver	—	100.0	None	—
O43143	DHX15	LQLPVWEYK	kidney	—	100.0	None	—
O43143	DHX15	TGHYLTVK	lung	—	100.0	None	—
O43148	RNMT	LEASETESFGNEIYTVK	liver	—	100.0	None	—
O43148	RNMT	LEASETESFGNEIYTVK	lung	—	100.0	None	—
O43148	RNMT	LPLGTLSK	liver	—	100.0	None	—
O43148	RNMT	LPLGTLSK	lung	—	100.0	None	—
O43148	RNMT	TFLEFYEEK	kidney	—	100.0	None	—
O43148	RNMT	TFLEFYEEK	liver	—	100.0	None	—
O43148	RNMT	TFLEFYEEK	lung	—	100.0	None	—
O43149	ZZEF1	AVIVDVK	kidney	—	100.0	None	—
O43149	ZZEF1	AVIVDVK	lung	—	100.0	None	—
O43149	ZZEF1	DGFLTETGK	kidney	—	100.0	None	—
O43149	ZZEF1	DGFLTETGK	lung	—	100.0	None	—
O43149	ZZEF1	FQTGFEILK	kidney	—	100.0	None	—

SysQuan Core Database

Cart (0)