SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
O00471	EXOC5	GGPEAFDPK	kidney	—	100.0	None	—
O00471	EXOC5	GGPEAFDPK	lung	—	100.0	None	—
O00471	EXOC5	HILAAEQK	liver	—	100.0	None	—
O00471	EXOC5	SIGTGGIQDLK	kidney	—	100.0	None	—
O00471	EXOC5	SNQVAFQHFQELDEHISYVATK	liver	—	100.0	None	—
O00471	EXOC5	TNLPLGPSIDTHGETFLSQEVVVNLLQETK	kidney	—	100.0	None	—
O00471	EXOC5	TNLPLGPSIDTHGETFLSQEVVVNLLQETK	liver	—	100.0	None	—
O00471	EXOC5	TNLPLGPSIDTHGETFLSQEVVVNLLQETK	lung	—	100.0	None	—
O00471	EXOC5	YFNEFLDGELK	liver	—	100.0	None	—
O00487	PSMD14	AVAVVVDPIQSVK	liver	—	100.0	None	—
O00487	PSMD14	AVAVVVDPIQSVK	plasma	—	100.0	None	—
O00487	PSMD14	QTTSNLGHLNK	liver	—	100.0	None	—
O00487	PSMD14	QTTSNLGHLNKPSIQALIHGLNR	kidney	—	100.0	None	—
O00499	BIN1	HHYESLQTAK	kidney	—	100.0	None	—
O00499	BIN1	HHYESLQTAK	lung	—	100.0	None	—
O00499	BIN1	TYLASVK	kidney	—	100.0	None	—
O00499	BIN1	TYLASVK	lung	—	100.0	None	—
O00499	BIN1	VGFYVNTFQSIAGLEENFHK	liver	—	100.0	None	—
O00499	BIN1	VGFYVNTFQSIAGLEENFHK	lung	—	100.0	None	—
O00499	BIN1	VQAQHDYTATDTDELQLK	liver	—	100.0	None	—
O00505	KPNA3	NPPIDDLIK	lung	—	100.0	None	—
O00505	KPNA3	NVPQEESLEDSDVDADFK	lung	—	100.0	None	—
O00505	KPNA3	SGILPILVK	kidney	—	100.0	None	—
O00505	KPNA3	SGILPILVK	lung	—	100.0	None	—
O00506	STK25	ADIWSLGITAIELAK	liver	—	100.0	None	—
O00506	STK25	GSFGEVYK	lung	—	100.0	None	—
O00506	STK25	PVFGELK	kidney	—	100.0	None	—
O00506	STK25	PVFGELK	lung	—	100.0	None	—
O00506	STK25	QSAYDFK	kidney	—	100.0	None	—
O00506	STK25	QSAYDFK	lung	—	100.0	None	—
O00506	STK25	VDPEELFTK	liver	—	100.0	None	—
O00506	STK25	YFGSYLK	kidney	—	100.0	None	—
O00506	STK25	YFGSYLK	lung	—	100.0	None	—
O00519	FAAH	QGLLYGVPVSLK	kidney	—	100.0	None	—
O00519	FAAH	QGLLYGVPVSLK	liver	—	100.0	None	—
O00519	FAAH	QGLLYGVPVSLK	lung	—	100.0	None	—
O00522	KRIT1	GNPENIEDAYVAVIRPK	kidney	—	100.0	None	—
O00522	KRIT1	GNPENIEDAYVAVIRPK	lung	—	100.0	None	—
O00522	KRIT1	SYEILLHEVPIEGQK	kidney	—	100.0	None	—
O00522	KRIT1	SYEILLHEVPIEGQK	lung	—	100.0	None	—
O00522	KRIT1	VIPVYVGVNIK	lung	—	100.0	None	—
O00522	KRIT1	VVINPYFGLGAPDYSK	lung	—	100.0	None	—
O00534	VWA5A	ELNKPVQGPLAHR	lung	—	100.0	None	—
O00534	VWA5A	IVAELQDK	kidney	—	100.0	None	—
O00534	VWA5A	IVAELQDK	liver	—	100.0	None	—
O00541	PES1	FLLHEPIVNK	lung	—	100.0	None	—
O00541	PES1	LAQEEESEAK	liver	—	100.0	None	—
O00559	EBAG9	QTDVEEWTSWDEDAPTSVK	kidney	—	100.0	None	—
O00559	EBAG9	QTDVEEWTSWDEDAPTSVK	liver	—	100.0	None	—
O00559	EBAG9	QTDVEEWTSWDEDAPTSVK	lung	—	100.0	None	—

SysQuan Core Database

Cart (0)