SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
P15104	GLUL	TCLLNETGDEPFQYK	liver	—	100.0	MRM	['Cys']
P15121	AKR1B1	MPLIGLGTWK	lung	—	100.0	MRM	['Meth']
P17936	IGFBP3	GFCWCVDK	kidney	—	100.0	MRM	['Cys']
P17936	IGFBP3	GFCWCVDK	lung	—	100.0	MRM	['Cys']
P17936	IGFBP3	GVHIPNCDK	plasma	—	100.0	MRM	['Cys']
P18065	IGFBP2	GECWCVNPNTGK	liver	—	100.0	MRM	['Cys']
P18206	VCL	EILGTCK	plasma	—	100.0	MRM	['Cys']
P18669	PGAM1	SYDVPPPPMEPDHPFYSNISK	lung	—	100.0	MRM	['Meth']
P18669	PGAM1	YADLTEDQLPSCESLK	lung	—	100.0	MRM	['Cys']
P19404	NDUFV2	QNGWLPISAMNK	lung	—	100.0	MRM	['Meth']
P20472	PVALB	FFQMVGLK	kidney	—	100.0	MRM	['Meth']
P21399	ACO1	DFESCLGAK	liver	—	100.0	MRM	['Cys']
P21399	ACO1	DFESCLGAK	plasma	—	100.0	MRM	['Cys']
P21912	SDHB	CGPMVLDALIK	lung	—	100.0	MRM	['Meth', 'Cys']
P21912	SDHB	IYPLPHMYVIK	liver	—	100.0	MRM	['Meth']
P22234	PAICS	VVVLMGSTSDLGHCEK	liver	—	100.0	MRM	['Meth', 'Cys']
P22352	GPX3	LFWEPMK	liver	—	100.0	MRM	['Meth']
P22352	GPX3	LFWEPMK	lung	—	100.0	MRM	['Meth']
P23229	ITGA6	FGSCQQGVAATFTK	lung	—	100.0	MRM	['Cys']
P23229	ITGA6	FGSCQQGVAATFTK	plasma	—	100.0	MRM	['Cys']
P23378	GLDC	DISLVHSMIPLGSCTMK	kidney	—	100.0	MRM	['Meth', 'Cys']
P23378	GLDC	SAHGTNPASAHMAGMK	kidney	—	100.0	MRM	['Meth']
P23378	GLDC	TFCIPHGGGGPGMGPIGVK	kidney	—	100.0	MRM	['Meth', 'Cys']
P24593	IGFBP5	GVCLNEK	kidney	—	100.0	MRM	['Cys']
P24821	TNC	ACGCAAAPDVK	plasma	—	100.0	MRM	['Cys']
P24821	TNC	DTDSAITNCALSYK	plasma	—	100.0	MRM	['Cys']
P26927	MST1	FQSCGIK	plasma	—	100.0	MRM	['Cys']
P28330	ACADL	VQPIYGGTNEIMK	liver	—	100.0	MRM	['Meth']
P28838	LAP3	ADMGGAATICSAIVSAAK	kidney	—	100.0	MRM	['Meth', 'Cys']
P28838	LAP3	ADMGGAATICSAIVSAAK	liver	—	100.0	MRM	['Meth', 'Cys']
P28838	LAP3	ADMGGAATICSAIVSAAK	lung	—	100.0	MRM	['Meth', 'Cys']
P28838	LAP3	LILADALCYAHTFNPK	kidney	—	100.0	MRM	['Cys']
P28838	LAP3	LILADALCYAHTFNPK	liver	—	100.0	MRM	['Cys']
P28838	LAP3	LILADALCYAHTFNPK	plasma	—	100.0	MRM	['Cys']
P30520	ADSS2	LDILDMFTEIK	kidney	—	100.0	MRM	['Meth']
P30520	ADSS2	LDILDMFTEIK	liver	—	100.0	MRM	['Meth']
P30520	ADSS2	LDILDMFTEIK	lung	—	100.0	MRM	['Meth']
P31327	CPS1	TVLMNPNIASVQTNEVGLK	lung	—	100.0	MRM	['Meth']
P31327	CPS1	VISHAISEHVEDAGVHSGDATLMLPTQTISQGAIEK	liver	—	100.0	MRM	['Meth']
P31930	UQCRC1	MVLAAAGGVEHQQLLDLAQK	kidney	—	100.0	MRM	['Meth']
P31930	UQCRC1	MVLAAAGGVEHQQLLDLAQK	liver	—	100.0	MRM	['Meth']
P34896	SHMT1	AVLEALGSCLNNK	dbs	—	100.0	MRM	['Cys']
P34896	SHMT1	AVLEALGSCLNNK	liver	—	100.0	MRM	['Cys']
P34896	SHMT1	AVLEALGSCLNNK	lung	—	100.0	MRM	['Cys']
P34896	SHMT1	IMGLDLPDGGHLTHGFMTDK	liver	—	100.0	MRM	['Meth']
P34897	SHMT2	ISATSIFFESMPYK	lung	—	100.0	MRM	['Meth']
P35520	CBS	CIIVMPEK	kidney	—	100.0	MRM	['Meth', 'Cys']
P35625	TIMP3	SCYYLPCFVTSK	dbs	—	100.0	MRM	['Cys']
P35625	TIMP3	SCYYLPCFVTSK	plasma	—	100.0	MRM	['Cys']
P35914	HMGCL	GYVSCALGCPYEGK	kidney	—	100.0	MRM	['Cys']

SysQuan Core Database

Cart (0)