SysQuan Core Database

Fast, large-scale absolute quantification for human samples. Unlike traditional methods requiring expensive synthetic peptides for each target, SysQuan uses metabolically K6-labeled mouse tissues with pre-quantified proteins. Simply mix your human samples with our standardized mouse tissue extracts to achieve absolute quantification across the entire proteome.

How to Use:

Search for proteins by gene name, UniProt accession, or peptide sequence
Filter by tissue type or assay availability (MRM, PRM-PASEF)
Select peptides to add them to your cart
Access MRM/PRM transitions, calibration curves, and observed peptide spectra
Download assay data

Available Data:

Optimized MRM & PRM-PASEF transitions for targeted MS
Absolute quantification calibration curves (fmol/μg)
Observed peptide MS/MS spectra from mouse tissues
Multi-tissue coverage across mouse organs

Use the SysQuan Kit: Pre-quantified K6-labeled mouse tissue extracts ready to spike into your human samples for rapid absolute quantification—no need for expensive synthetic peptide standards!

Uniprot ID	Gene	Peptide Sequence	Tissue	Mouse Conc. (fmol/μg)	Incorp. (%)	Assays Available	PTM
P04899	GNAI2	YDEAASYIQSK	Spleen	—	100.0	MRM	—
P05062	ALDOB	ALQASALAAWGGK	dbs	—	100.0	MRM	—
P05062	ALDOB	ALQASALAAWGGK	liver	—	100.0	MRM	—
P05062	ALDOB	ALQASALAAWGGK	plasma	—	100.0	MRM	—
P05067	APP	WYFDVTEGK	Heart	—	100.0	MRM	—
P05067	APP	WYFDVTEGK	lung	—	100.0	MRM	—
P05067	APP	WYFDVTEGK	Spleen	—	100.0	MRM	—
P05091	ALDH2	VTLELGGK	liver	—	100.0	MRM	—
P05091	ALDH2	VTLELGGK	lung	—	100.0	MRM	—
P05106	ITGB3	NDASHLLVFTTDAK	Heart	—	100.0	MRM	—
P05106	ITGB3	NDASHLLVFTTDAK	kidney	—	100.0	MRM	—
P05106	ITGB3	NDASHLLVFTTDAK	lung	—	100.0	MRM	—
P05106	ITGB3	NDASHLLVFTTDAK	plasma	—	100.0	MRM	—
P05141	SLC25A5	TDAAVSFAK	dbs	—	100.0	MRM	—
P05141	SLC25A5	TDAAVSFAK	lung	—	100.0	MRM	—
P05141	SLC25A5	TDAAVSFAK	plasma	—	100.0	MRM	—
P05141	SLC25A5	TDAAVSFAK	Spleen	—	100.0	MRM	—
P05165	PCCA	FLSDVYPDGFK	lung	—	100.0	MRM	—
P05165	PCCA	VYAEDPYK	lung	—	100.0	MRM	—
P05166	PCCB	LLYAFAEATVPK	liver	—	100.0	MRM	—
P05387	RPLP2	VISELNGK	liver	—	100.0	MRM	—
P05387	RPLP2	VISELNGK	lung	—	100.0	MRM	—
P05387	RPLP2	VISELNGK	plasma	—	100.0	MRM	—
P05387	RPLP2	VISELNGK	Spleen	—	100.0	MRM	—
P05556	ITGB1	WDTGENPIYK	dbs	—	100.0	MRM	—
P05556	ITGB1	WDTGENPIYK	plasma	—	100.0	MRM	—
P06312	IGKV4-1	NYLAWYQQK	liver	—	100.0	MRM	—
P06396	GSN	TEALTSAK	lung	—	100.0	MRM	—
P06396	GSN	TEALTSAK	plasma	—	100.0	MRM	—
P06454	PTMA	SDAAVDTSSEITTK	kidney	—	100.0	MRM	—
P06454	PTMA	SDAAVDTSSEITTK	lung	—	100.0	MRM	—
P06576	ATP5F1B	VVDLLAPYAK	liver	—	100.0	MRM	—
P06576	ATP5F1B	VVDLLAPYAK	plasma	—	100.0	MRM	—
P06576	ATP5F1B	VVDLLAPYAK	Spleen	—	100.0	MRM	—
P06730	EIF4E	IVIGYQSHADTATK	dbs	—	100.0	MRM	—
P06730	EIF4E	IVIGYQSHADTATK	Heart	—	100.0	MRM	—
P06730	EIF4E	IVIGYQSHADTATK	kidney	—	100.0	MRM	—
P06730	EIF4E	IVIGYQSHADTATK	liver	—	100.0	MRM	—
P06730	EIF4E	IVIGYQSHADTATK	Spleen	—	100.0	MRM	—
P06732	CKM	LNYKPEEEYPDLSK	lung	—	100.0	MRM	—
P06733	ENO1	IGAEVYHNLK	dbs	—	100.0	MRM	—
P06733	ENO1	IGAEVYHNLK	kidney	—	100.0	MRM	—
P06733	ENO1	IGAEVYHNLK	liver	—	100.0	MRM	—
P06733	ENO1	IGAEVYHNLK	lung	—	100.0	MRM	—
P06737	PYGL	HLEIIYEINQK	dbs	—	100.0	MRM	—
P06737	PYGL	HLEIIYEINQK	Spleen	—	100.0	MRM	—
P06744	GPI	TFTTQETITNAETAK	liver	—	100.0	MRM	—
P06744	GPI	TFTTQETITNAETAK	lung	—	100.0	MRM	—
P06744	GPI	VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK	Heart	—	100.0	MRM	—
P06744	GPI	VDHQTGPIVWGEPGTNGQHAFYQLIHQGTK	kidney	—	100.0	MRM	—

SysQuan Core Database

Cart (0)